Fibronectin Rabbit pAb (APR19548N)
Product Specifications
Background
This gene encodes fibronectin, a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. The encoded preproprotein is proteolytically processed to generate the mature protein. Fibronectin is involved in cell adhesion and migration processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis. The gene has three regions subject to alternative splicing, with the potential to produce 20 different transcript variants, at least one of which encodes an isoform that undergoes proteolytic processing. The full-length nature of some variants has not been determined.
Overview
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Fibronectin Rabbit pAb (APR19548N) .
Synonyms
FN1; CIG; ED-B; FINC; FN; FNZ; GFND; GFND2; LETS; MSF; fibronectin
Gene ID
2335
UniProt
P02751
Cellular Locus
Secreted, extracellular matrix, extracellular space
Applications
WB (mouse cells, Mus musculus, Homo sapiens) IHC (Mus musculus, Rattus norvegicus) ICC (Homo sapiens)
Dilution
WB 1:500 - 1:1000 IHC 1:50 - 1:200 IF 1:50 - 1:200
Form
Liquid
Buffer
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Molecular Weight
Calculated MW: 71-73kDa/221-272kDa Observed MW: 272KDa
Storage Conditions
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Gene ID URL
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2335
Uniprot URL
https://www.uniprot.org/uniprot/P02751
AA Sequence
LLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040204-100 1x 100 µL
Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040026-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940149-500 1x 500 µL
CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402848-100 1x 100 µL
Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details