Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fibronectin Rabbit pAb (APR19548N)

Product Specifications

Background

This gene encodes fibronectin, a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. The encoded preproprotein is proteolytically processed to generate the mature protein. Fibronectin is involved in cell adhesion and migration processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis. The gene has three regions subject to alternative splicing, with the potential to produce 20 different transcript variants, at least one of which encodes an isoform that undergoes proteolytic processing. The full-length nature of some variants has not been determined.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Fibronectin Rabbit pAb (APR19548N) .

Synonyms

FN1; CIG; ED-B; FINC; FN; FNZ; GFND; GFND2; LETS; MSF; fibronectin

Gene ID

2335

UniProt

P02751

Cellular Locus

Secreted, extracellular matrix, extracellular space

Applications

WB (mouse cells, Mus musculus, Homo sapiens) IHC (Mus musculus, Rattus norvegicus) ICC (Homo sapiens)

Dilution

WB 1:500 - 1:1000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 71-73kDa/221-272kDa Observed MW: 272KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2335

Uniprot URL

https://www.uniprot.org/uniprot/P02751

AA Sequence

LLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIC1 Polyclonal Antibody
E-AB-66161-01 60 µL

HIC1 Polyclonal Antibody

Sign In for Pricing
View Details
HIC1 Polyclonal Antibody
E-AB-66161-02 120 µL

HIC1 Polyclonal Antibody

Sign In for Pricing
View Details
HIC1 Polyclonal Antibody
E-AB-66161-03 200 µL

HIC1 Polyclonal Antibody

Sign In for Pricing
View Details
Uncoated Rat sCD86 (Soluble Cluster of Differentiation 86) ELISA Kit
E-UNEL-R0014-01 5x 96 Tests

Uncoated Rat sCD86 (Soluble Cluster of Differentiation 86) ELISA Kit

Sign In for Pricing
View Details
Uncoated Rat sCD86 (Soluble Cluster of Differentiation 86) ELISA Kit
E-UNEL-R0014-02 15x 96 Tests

Uncoated Rat sCD86 (Soluble Cluster of Differentiation 86) ELISA Kit

Sign In for Pricing
View Details
N,N-Diethylaniline
TRC-D443520-10G 10 g

N,N-Diethylaniline

Sign In for Pricing
View Details