Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

F5 Rabbit pAb (APR19535N)

Product Specifications

Background

This gene encodes an essential cofactor of the blood coagulation cascade. This factor circulates in plasma, and is converted to the active form by the release of the activation peptide by thrombin during coagulation. This generates a heavy chain and a light chain which are held together by calcium ions. The activated protein is a cofactor that participates with activated coagulation factor X to activate prothrombin to thrombin. Defects in this gene result in either an autosomal recessive hemorrhagic diathesis or an autosomal dominant form of thrombophilia, which is known as activated protein C resistance.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality F5 Rabbit pAb (APR19535N) .

Synonyms

F5; FVL; PCCF; RPRGL1; THPH2

Gene ID

2153

UniProt

P12259

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 251kDa Observed MW: 290kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2153

Uniprot URL

https://www.uniprot.org/uniprot/P12259

AA Sequence

VGPEGKWIISSLTPKHLQAGMQAYIDIKNCPKKTRNLKKITREQRRHMKRWEYFIAAEEVIWDYAPVIPANMDKKYRSQHLDNFSNQIGKHYKKVMYTQYEDESFTKHTVNPNMKEDGILGPIIRAQVRDTLKIVFKNMASRPYSIYPHGVTFSPYEDEVNSSFTSGRNNTMIRAVQPGETYTYKWNILEFDEPTENDAQCLTRPYYSDVD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SKP1, aa1-160, Recombinant, Human (S-phase kinase-associated protein, EMC19, MGC34403, OCP-II, OCP2, p19A, SKP1A, TCEB1L)
MBS637216-01 0.1 mg

SKP1, aa1-160, Recombinant, Human (S-phase kinase-associated protein, EMC19, MGC34403, OCP-II, OCP2, p19A, SKP1A, TCEB1L)

Sign In for Pricing
View Details
SKP1, aa1-160, Recombinant, Human (S-phase kinase-associated protein, EMC19, MGC34403, OCP-II, OCP2, p19A, SKP1A, TCEB1L)
MBS637216-02 5x 0.1 mg

SKP1, aa1-160, Recombinant, Human (S-phase kinase-associated protein, EMC19, MGC34403, OCP-II, OCP2, p19A, SKP1A, TCEB1L)

Sign In for Pricing
View Details
Fgf5 Mouse qPCR Primer Pair (NM_010203)
MP204818 200 Reactions

Fgf5 Mouse qPCR Primer Pair (NM_010203)

Sign In for Pricing
View Details
Centaurin beta 2 Recombinant Rabbit mAb
E43S46867 100 µL

Centaurin beta 2 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Phosphoglycerate Kinase 1 (PGK1, Cell Migration-inducing Gene 10 Protein, MGC8947, MGC117307, MGC142128, MIG10, OK/SW-cl.110, PGKA, Primer Recognition Protein 2, PRP 2) (AP) discontinued
P4073-13B-AP 200 µL

Phosphoglycerate Kinase 1 (PGK1, Cell Migration-inducing Gene 10 Protein, MGC8947, MGC117307, MGC142128, MIG10, OK/SW-cl.110, PGKA, Primer Recognition Protein 2, PRP 2) (AP) discontinued

Sign In for Pricing
View Details
IL-6 Protein (N-His, Rat)
P516286 100 µg

IL-6 Protein (N-His, Rat)

Sign In for Pricing
View Details