Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

F5 Rabbit pAb (APR19535N)

Product Specifications

Background

This gene encodes an essential cofactor of the blood coagulation cascade. This factor circulates in plasma, and is converted to the active form by the release of the activation peptide by thrombin during coagulation. This generates a heavy chain and a light chain which are held together by calcium ions. The activated protein is a cofactor that participates with activated coagulation factor X to activate prothrombin to thrombin. Defects in this gene result in either an autosomal recessive hemorrhagic diathesis or an autosomal dominant form of thrombophilia, which is known as activated protein C resistance.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality F5 Rabbit pAb (APR19535N) .

Synonyms

F5; FVL; PCCF; RPRGL1; THPH2

Gene ID

2153

UniProt

P12259

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 251kDa Observed MW: 290kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2153

Uniprot URL

https://www.uniprot.org/uniprot/P12259

AA Sequence

VGPEGKWIISSLTPKHLQAGMQAYIDIKNCPKKTRNLKKITREQRRHMKRWEYFIAAEEVIWDYAPVIPANMDKKYRSQHLDNFSNQIGKHYKKVMYTQYEDESFTKHTVNPNMKEDGILGPIIRAQVRDTLKIVFKNMASRPYSIYPHGVTFSPYEDEVNSSFTSGRNNTMIRAVQPGETYTYKWNILEFDEPTENDAQCLTRPYYSDVD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAG1 Protein Vector (Mouse) (pPM-C-HA)
38448024 500 ng

RAG1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
C1orf58 Protein Vector (Human) (pPM-C-HA)
PV049799 500 ng

C1orf58 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
PPP2R2B (Serine/Threonine-protein Phosphatase 2A 55kD Regulatory Subunit B beta Isoform, PP2A, Subunit B Isoform B55-beta, PP2A Subunit B Isoform PR55-beta, PP2A Subunit B Isoform R2-beta, PP2A Subunit B Isoform beta, FLJ95686, MGC24888) APC
MBS6390451-01 0.1 mL

PPP2R2B (Serine/Threonine-protein Phosphatase 2A 55kD Regulatory Subunit B beta Isoform, PP2A, Subunit B Isoform B55-beta, PP2A Subunit B Isoform PR55-beta, PP2A Subunit B Isoform R2-beta, PP2A Subunit B Isoform beta, FLJ95686, MGC24888) APC

Sign In for Pricing
View Details
PPP2R2B (Serine/Threonine-protein Phosphatase 2A 55kD Regulatory Subunit B beta Isoform, PP2A, Subunit B Isoform B55-beta, PP2A Subunit B Isoform PR55-beta, PP2A Subunit B Isoform R2-beta, PP2A Subunit B Isoform beta, FLJ95686, MGC24888) APC
MBS6390451-02 5x 0.1 mL

PPP2R2B (Serine/Threonine-protein Phosphatase 2A 55kD Regulatory Subunit B beta Isoform, PP2A, Subunit B Isoform B55-beta, PP2A Subunit B Isoform PR55-beta, PP2A Subunit B Isoform R2-beta, PP2A Subunit B Isoform beta, FLJ95686, MGC24888) APC

Sign In for Pricing
View Details
Anti-Human/Mouse/Rat CD47 Monoclonal Antibody (APC Conjugated)
MBS2558101-01 20 Tests

Anti-Human/Mouse/Rat CD47 Monoclonal Antibody (APC Conjugated)

Sign In for Pricing
View Details
Anti-Human/Mouse/Rat CD47 Monoclonal Antibody (APC Conjugated)
MBS2558101-02 100 Tests

Anti-Human/Mouse/Rat CD47 Monoclonal Antibody (APC Conjugated)

Sign In for Pricing
View Details