Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RUFY3 Rabbit pAb (APR19511N)

Product Specifications

Background

This gene encodes a RPIP8, UNC-14, and NESCA domain-containing protein that is required for maintenance of neuronal polarity. In addition, it has been implicated in mediation of gastric cancer cell migration and invasion via interaction with P21-activated kinase-1, which promotes its expression. The encoded protein localizes to F-actin-enriched invadopodia to induce formation of protrusions, thereby facilitating cell migration. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RUFY3 Rabbit pAb (APR19511N) .

Synonyms

RUFY3; RIPX; SINGAR1; ZFYVE30

Gene ID

22902

UniProt

Q7L099

Cellular Locus

Cell projection, Cytoplasm, Endomembrane system, Perikaryon, filopodium, growth cone, invadopodium, lamellipodium

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 52kDa/55kDa/64kDa/70kDa Observed MW: 56kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=22902

Uniprot URL

https://www.uniprot.org/uniprot/Q7L099

AA Sequence

MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHEDPNYLM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) Mouse Monoclonal Antibody
MBS439814-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) Mouse Monoclonal Antibody
MBS439814-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) Mouse Monoclonal Antibody
MBS439814-03 0.1 mg (Without BSA & Azide at 1mg/mL)

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) Mouse Monoclonal Antibody
MBS439814-04 5x 0.1 mg (With BSA & Azide at 0.2mg/mL)

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) Mouse Monoclonal Antibody
MBS439814-05 5x 0.1 mg (Without BSA & Azide at 1mg/mL)

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Mianserin (hydrochloride)
HY-B0188A-01 50 mg

Mianserin (hydrochloride)

Sign In for Pricing
View Details