Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FCER1G Rabbit pAb (APR19503N)

Product Specifications

Background

The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FCER1G Rabbit pAb (APR19503N) .

Synonyms

FCER1G; FCRG

Gene ID

2207

UniProt

P30273

Cellular Locus

Cell membrane, Single-pass type I membrane protein

Dilution

WB 1:1000 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 9kDa Observed MW: 12kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2207

Uniprot URL

https://www.uniprot.org/uniprot/P30273

AA Sequence

LGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRLF1 (Cytokine Receptor-like Factor 1, Cytokine-like Factor 1, CLF-1, ZcytoR5, UNQ288/PRO327) (Biotin)
MBS6374744-01 0.1 mL

CRLF1 (Cytokine Receptor-like Factor 1, Cytokine-like Factor 1, CLF-1, ZcytoR5, UNQ288/PRO327) (Biotin)

Sign In for Pricing
View Details
CRLF1 (Cytokine Receptor-like Factor 1, Cytokine-like Factor 1, CLF-1, ZcytoR5, UNQ288/PRO327) (Biotin)
MBS6374744-02 5x 0.1 mL

CRLF1 (Cytokine Receptor-like Factor 1, Cytokine-like Factor 1, CLF-1, ZcytoR5, UNQ288/PRO327) (Biotin)

Sign In for Pricing
View Details
GLEPP1 (PTPRO) (NM_030669) Human Over-expression Lysate
LC410737 20 µg

GLEPP1 (PTPRO) (NM_030669) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O127:H6 (strain E2348/69/EPEC) YOHO Polyclonal Antibody
MBS7177429 Inquire

Rabbit anti-Escherichia coli O127:H6 (strain E2348/69/EPEC) YOHO Polyclonal Antibody

Sign In for Pricing
View Details
Chst5 (NM_001107431) Rat Tagged Lenti ORF Clone
RR209557L4 10 µg

Chst5 (NM_001107431) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RCN2 (Reticulocalbin 2, Reticulocalbin-2, Calcium-binding Protein ERC-55, E6-binding Protein, E6BP, ERC55)
MBS6006990-01 0.2 mL

RCN2 (Reticulocalbin 2, Reticulocalbin-2, Calcium-binding Protein ERC-55, E6-binding Protein, E6BP, ERC55)

Sign In for Pricing
View Details