Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTN3 Rabbit pAb (APR19477N)

Product Specifications

Background

This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ACTN3 Rabbit pAb (APR19477N) .

Synonyms

ACTN3

Gene ID

89

UniProt

Q08043

Dilution

WB 1:1000 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 103kDa Observed MW: 103kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=89

Uniprot URL

https://www.uniprot.org/uniprot/Q08043

AA Sequence

GAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTKWDMVRKLVPSCDQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dihydrorhodamine 123, dihydrochloride salt, 20x500ug
#10056-1 20x 500 µg

Dihydrorhodamine 123, dihydrochloride salt, 20x500ug

Sign In for Pricing
View Details
CD137L / 4-1BBL / TNFSF9 (CD137L/1547), CF488A conjugate, 0.1mg/mL
BNC881547-500 1x 500 µL

CD137L / 4-1BBL / TNFSF9 (CD137L/1547), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HEX-dT Phosphoramidite
6210-AAT 50 µmole

HEX-dT Phosphoramidite

Sign In for Pricing
View Details
CLTRN antibody
FNab08777 100 µg

CLTRN antibody

Sign In for Pricing
View Details
LC3B Recombinant Chimeric Antibody Antibody
HA610352 100 µL

LC3B Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Mouse 1700001G11Rik activation kit by CRISPRa
GA208123 1 Kit

Mouse 1700001G11Rik activation kit by CRISPRa

Sign In for Pricing
View Details