Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-B Rabbit pAb (APR19462N)

Product Specifications

Background

HLA-B belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin) . The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from the endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon 1 encodes the leader peptide, exon 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Hundreds of HLA-B alleles have been described.

Synonyms

HLA-B; AS; B-4901; HLAB; Bw-47; Bw-50; SPDA1

Gene ID

3106

UniProt

P01889

Cellular Locus

Membrane, Single-pass type I membrane protein

Dilution

WB 1:1000 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 40kDa Observed MW: 40kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HLA-B Rabbit pAb (APR19462N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3106

Uniprot URL

https://www.uniprot.org/uniprot/P01889

AA Sequence

MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRE

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Laminin B2, gamma1 (BSA & Azide Free) (AP)
MBS6265901-01 0.1 mL

Laminin B2, gamma1 (BSA & Azide Free) (AP)

Ask
View Details
Laminin B2, gamma1 (BSA & Azide Free) (AP)
MBS6265901-02 5x 0.1 mL

Laminin B2, gamma1 (BSA & Azide Free) (AP)

Ask
View Details
Human Scavenger receptor class B member 1 (SCARB1) Elisa Kit
EK713606 96 Well

Human Scavenger receptor class B member 1 (SCARB1) Elisa Kit

Ask
View Details
Bacillus amyloliquefaciens
PGPR-0010BF-01 25 Kg

Bacillus amyloliquefaciens

Ask
View Details
Bacillus amyloliquefaciens
PGPR-0010BF-02 1000 Kg

Bacillus amyloliquefaciens

Ask
View Details
BAZ2A CRISPR All-in-one AAV vector set (with saCas9)(Human)
13029151 3x1.0μg DNA

BAZ2A CRISPR All-in-one AAV vector set (with saCas9)(Human)

Ask
View Details