Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK11B Rabbit pAb (APR19441N)

Product Specifications

Background

This gene encodes a member of the serine/threonine protein kinase family. Members of this kinase family are known to be essential for eukaryotic cell cycle control. Due to a segmental duplication, this gene shares very high sequence identity with a neighboring gene. These two genes are frequently deleted or altered in neuroblastoma. The protein kinase encoded by this gene can be cleaved by caspases and may play a role in cell apoptosis. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CDK11B Rabbit pAb (APR19441N) .

Synonyms

CDK11B; CDC2L1; CDK11; CDK11-p110; CDK11-p46; CDK11-p58; CLK-1; PITSLREA; PK58; p58; p58CDC2L1; p58CLK-1

Gene ID

984

UniProt

P21127

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 49-92kDa Observed MW: 110kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=984

Uniprot URL

https://www.uniprot.org/uniprot/P21127

AA Sequence

MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGKHARVKEKERE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 10/13 (DE-K13), 0.2mg/mL
BNUB0696-100 1x 100 µL

Cytokeratin 10/13 (DE-K13), 0.2mg/mL

Sign In for Pricing
View Details
Heptakis(6-O-sulfo)-Beta-cyclodextrin Heptasodium Salt (>90%)
TRC-H281125-10MG 10 mg

Heptakis(6-O-sulfo)-Beta-cyclodextrin Heptasodium Salt (>90%)

Sign In for Pricing
View Details
Aminopropargyl dUTP [5-Propargylamino-2'-deoxyuridine-5'-triphosphate]
17053-AAT 10 µmole

Aminopropargyl dUTP [5-Propargylamino-2'-deoxyuridine-5'-triphosphate]

Sign In for Pricing
View Details
Primer Panel
HPP6017C 20x 96 Pre-Arrayed Plates

Primer Panel

Sign In for Pricing
View Details
MEK1 (MAP2K1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E8]
TA506020AM 100 µL

MEK1 (MAP2K1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E8]

Sign In for Pricing
View Details
Bnc2 Mouse Gene Knockout Kit (CRISPR)
KN502211 1 Kit

Bnc2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details