Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK11B Rabbit pAb (APR19441N)

Product Specifications

Background

This gene encodes a member of the serine/threonine protein kinase family. Members of this kinase family are known to be essential for eukaryotic cell cycle control. Due to a segmental duplication, this gene shares very high sequence identity with a neighboring gene. These two genes are frequently deleted or altered in neuroblastoma. The protein kinase encoded by this gene can be cleaved by caspases and may play a role in cell apoptosis. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CDK11B Rabbit pAb (APR19441N) .

Synonyms

CDK11B; CDC2L1; CDK11; CDK11-p110; CDK11-p46; CDK11-p58; CLK-1; PITSLREA; PK58; p58; p58CDC2L1; p58CLK-1

Gene ID

984

UniProt

P21127

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 49-92kDa Observed MW: 110kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=984

Uniprot URL

https://www.uniprot.org/uniprot/P21127

AA Sequence

MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGKHARVKEKERE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSPY8 Human Gene Knockout Kit (CRISPR)
KN433706 1 Kit

TSPY8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (N/A), CF594 conjugate, 0.1mg/mL
BNC941851-500 1x 500 µL

P53 Tumor Suppressor Protein (N/A), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Asphd1 Mouse Gene Knockout Kit (CRISPR)
KN501691 1 Kit

Asphd1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Phospho-Axl (Y702) Recombinant Rabbit monoclonal Antibody
HA723963 100 µL

Phospho-Axl (Y702) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Midkine (MDK) (NM_002391) Human Over-expression Lysate
LC419358 20 µg

Midkine (MDK) (NM_002391) Human Over-expression Lysate

Sign In for Pricing
View Details
2-Naphthylamine Hydrochloride
TRC-N378020-10MG 10 mg

2-Naphthylamine Hydrochloride

Sign In for Pricing
View Details