Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL42 Rabbit pAb (APR19422N)

Product Specifications

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a protein identified as belonging to both the 28S and the 39S subunits. Alternative splicing results in multiple transcript variants. Pseudogenes corresponding to this gene are found on chromosomes 4q, 6p, 6q, 7p, and 15q.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MRPL42 Rabbit pAb (APR19422N) .

Synonyms

MRPL42; HSPC204; L31MT; L42MT; MRP-L31; MRP-L42; MRP-S32; MRPL31; MRPS32; PTD007; RPML31; S32MT

Gene ID

28977

UniProt

Q9Y6G3

Cellular Locus

Mitochondrion

Dilution

WB 1:1000 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 16kDa Observed MW: 16kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=28977

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y6G3

AA Sequence

MAVAAVKWVMSKRTILKHLFPVQNGALYCVCHKSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MOBKL1B, CT (Mps One Binder Kinase Activator-like 1B, Mob1 Homolog 1B, MOBK1B, C2orf6, FLJ10788, FLJ11595, MATS1, MOB4B, Protein Mob4B)
MBS624334-01 0.2 mL

MOBKL1B, CT (Mps One Binder Kinase Activator-like 1B, Mob1 Homolog 1B, MOBK1B, C2orf6, FLJ10788, FLJ11595, MATS1, MOB4B, Protein Mob4B)

Ask
View Details
MOBKL1B, CT (Mps One Binder Kinase Activator-like 1B, Mob1 Homolog 1B, MOBK1B, C2orf6, FLJ10788, FLJ11595, MATS1, MOB4B, Protein Mob4B)
MBS624334-02 5x 0.2 mL

MOBKL1B, CT (Mps One Binder Kinase Activator-like 1B, Mob1 Homolog 1B, MOBK1B, C2orf6, FLJ10788, FLJ11595, MATS1, MOB4B, Protein Mob4B)

Ask
View Details
Recombinant Actinobacillus pleuropneumoniae 40 kDa major outer membrane protein
MBS1220131-01 0.05 mg (E-Coli)

Recombinant Actinobacillus pleuropneumoniae 40 kDa major outer membrane protein

Ask
View Details
Recombinant Actinobacillus pleuropneumoniae 40 kDa major outer membrane protein
MBS1220131-02 0.2 mg (E-Coli)

Recombinant Actinobacillus pleuropneumoniae 40 kDa major outer membrane protein

Ask
View Details
Recombinant Actinobacillus pleuropneumoniae 40 kDa major outer membrane protein
MBS1220131-03 0.05 mg (Yeast)

Recombinant Actinobacillus pleuropneumoniae 40 kDa major outer membrane protein

Ask
View Details
Recombinant Actinobacillus pleuropneumoniae 40 kDa major outer membrane protein
MBS1220131-04 0.5 mg (E-Coli)

Recombinant Actinobacillus pleuropneumoniae 40 kDa major outer membrane protein

Ask
View Details