Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HYI Rabbit pAb (APR19417N)

Product Specifications

Background

This gene encodes a putative hydroxypyruvate isomerase, which likely catalyzes the conversion of hydroxypyruvate to 2-hydroxy-3-oxopropanoate, and may be involved in carbohydrate transport and metabolism. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HYI Rabbit pAb (APR19417N) .

Synonyms

HYI; HT036

Gene ID

81888

UniProt

Q5T013

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 19kDa/22kDa/26kDa/30kDa Observed MW: 30kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=81888

Uniprot URL

https://www.uniprot.org/uniprot/Q5T013

AA Sequence

PGRQAAFREGLEQAVRYAKALGCPRIHLMAGRVPQGADRIAVKAEMEAVFLENLRHAAGVLAQEDLVGLLEPINTRITDPQYFLDTPQQAAAILQKVGRPNLQLQMDIFHWQIMDGNLTGNIREFLPIVGHVQVAQVPGRGEPSSPGELNFPYLFQLLEDEGYKGFVGCEYQPRGDTVEGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Joint
CS807245 5x 5 µm

Tissue FFPE Sections, Joint

Sign In for Pricing
View Details
Human NBPF3 activation kit by CRISPRa
GA113432 1 Kit

Human NBPF3 activation kit by CRISPRa

Sign In for Pricing
View Details
CD11b / MAC-1 (Microglial Marker) (ITGAM/3340), CF647 conjugate, 0.1mg/mL
BNC473340-100 1x 100 µL

CD11b / MAC-1 (Microglial Marker) (ITGAM/3340), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KBTBD12 (NM_207335) Human Over-expression Lysate
LY403962 100 µg

KBTBD12 (NM_207335) Human Over-expression Lysate

Sign In for Pricing
View Details
TentaGel® R TRT-Cl
R28031.5G 5 g

TentaGel® R TRT-Cl

Sign In for Pricing
View Details
ZNF18 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H4]
TA810109AM 100 µL

ZNF18 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H4]

Sign In for Pricing
View Details