Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTN3 Rabbit pAb (APR19408N)

Product Specifications

Background

This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ACTN3 Rabbit pAb (APR19408N) .

Synonyms

ACTN3

Gene ID

89

UniProt

Q08043

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 103kDa Observed MW: 103kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=89

Uniprot URL

https://www.uniprot.org/uniprot/Q08043

AA Sequence

GAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTKWDMVRKLVPSCDQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFA10L1 Adenovirus (Rat)
31613056 1.0 mL

NDUFA10L1 Adenovirus (Rat)

Sign In for Pricing
View Details
FADD (Fas (TNFRSF6)-Associated via Death Domain, GIG3, MGC8528, MORT1) (MaxLight 750)
MBS6238142-01 0.1 mL

FADD (Fas (TNFRSF6)-Associated via Death Domain, GIG3, MGC8528, MORT1) (MaxLight 750)

Sign In for Pricing
View Details
FADD (Fas (TNFRSF6)-Associated via Death Domain, GIG3, MGC8528, MORT1) (MaxLight 750)
MBS6238142-02 5x 0.1 mL

FADD (Fas (TNFRSF6)-Associated via Death Domain, GIG3, MGC8528, MORT1) (MaxLight 750)

Sign In for Pricing
View Details
ECE2 (EEF1AKMT4) (NM_032331) Human Tagged ORF Clone Lentiviral Particle
RC214910L4V 200 µL

ECE2 (EEF1AKMT4) (NM_032331) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PDS5A, CT (PDS5A, KIAA0648, PDS5, Sister chromatid cohesion protein PDS5 homolog A, Cell proliferation-inducing gene 54 protein, Sister chromatid cohesion protein 112) (APC) discontinued
039856-APC 200 µL

PDS5A, CT (PDS5A, KIAA0648, PDS5, Sister chromatid cohesion protein PDS5 homolog A, Cell proliferation-inducing gene 54 protein, Sister chromatid cohesion protein 112) (APC) discontinued

Sign In for Pricing
View Details
Bovine Indoleamine-2,3-Dioxygenase (IDO) ELISA Kit
OM623548 96 Strip Well

Bovine Indoleamine-2,3-Dioxygenase (IDO) ELISA Kit

Sign In for Pricing
View Details