Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTN3 Rabbit pAb (APR19408N)

Product Specifications

Background

This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ACTN3 Rabbit pAb (APR19408N) .

Synonyms

ACTN3

Gene ID

89

UniProt

Q08043

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 103kDa Observed MW: 103kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=89

Uniprot URL

https://www.uniprot.org/uniprot/Q08043

AA Sequence

GAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTKWDMVRKLVPSCDQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NALF1 Human Gene Knockout Kit (CRISPR)
KN423515 1 Kit

NALF1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lentiviral mouse Pdzrn4 shRNA (UAS) - Lentiviral mouse Pdzrn4 shRNA (UAS, RFP) (100)
GTR15242928 1 Vial

Lentiviral mouse Pdzrn4 shRNA (UAS) - Lentiviral mouse Pdzrn4 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Apolipoprotein E4 Polyclonal Antibody Bio Conjugated
C92295Bio 100 µL

Apolipoprotein E4 Polyclonal Antibody Bio Conjugated

Sign In for Pricing
View Details
Monoclonal PAX7 (Rhabdomyosarcoma Marker) Antibody - Without BSA and Azide, Clone: PAX7/497
AMM00353G 0.1mg

Monoclonal PAX7 (Rhabdomyosarcoma Marker) Antibody - Without BSA and Azide, Clone: PAX7/497

Sign In for Pricing
View Details
Α-1-syntrophin (SNTA1) Rabbit ELISA Kit
B3969 96 Tests

Α-1-syntrophin (SNTA1) Rabbit ELISA Kit

Sign In for Pricing
View Details
MMP11 Antibody
49045-01 50 µL

MMP11 Antibody

Sign In for Pricing
View Details