Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGFR1 Rabbit pAb (APR19386N)

Product Specifications

Background

This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig) -like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality VEGFR1 Rabbit pAb (APR19386N) .

Synonyms

FLT; FLT-1; VEGFR-1; VEGFR1; FLT1

Gene ID

2321

UniProt

P17948

Cellular Locus

Cell membrane, Cytoplasm, Endosome, Secreted, Single-pass type I membrane protein

Applications

WB (Homo sapiens, Gallus gallus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 39kDa/41kDa/52- 82kDa/150kDa Observed MW: 151kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2321

Uniprot URL

https://www.uniprot.org/uniprot/P17948

AA Sequence

LTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse LAMP-1/CD107a Affinity Purified Polyclonal Ab
AF4320-SP 25 µg

Mouse LAMP-1/CD107a Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
SFMBT1, NT (SFMBT1, RU1, Scm-like with four MBT domains protein 1, Renal ubiquitous protein 1) (Azide free) (HRP)
MBS6346585-01 0.2 mL

SFMBT1, NT (SFMBT1, RU1, Scm-like with four MBT domains protein 1, Renal ubiquitous protein 1) (Azide free) (HRP)

Sign In for Pricing
View Details
SFMBT1, NT (SFMBT1, RU1, Scm-like with four MBT domains protein 1, Renal ubiquitous protein 1) (Azide free) (HRP)
MBS6346585-02 5x 0.2 mL

SFMBT1, NT (SFMBT1, RU1, Scm-like with four MBT domains protein 1, Renal ubiquitous protein 1) (Azide free) (HRP)

Sign In for Pricing
View Details
GRIK2 Antibody, Biotin Conjugated
MBS7134066-01 0.05 mL

GRIK2 Antibody, Biotin Conjugated

Sign In for Pricing
View Details
GRIK2 Antibody, Biotin Conjugated
MBS7134066-02 0.1 mL

GRIK2 Antibody, Biotin Conjugated

Sign In for Pricing
View Details
GRIK2 Antibody, Biotin Conjugated
MBS7134066-03 5x 0.1 mL

GRIK2 Antibody, Biotin Conjugated

Sign In for Pricing
View Details