Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAG1 Rabbit pAb (APR19373N)

Product Specifications

Background

The jagged 1 protein encoded by JAG1 is the human homolog of the Drosophilia jagged protein. Human jagged 1 is the ligand for the receptor notch 1, the latter a human homolog of the Drosophilia jagged receptor notch. Mutations that alter the jagged 1 protein cause Alagille syndrome. Jagged 1 signalling through notch 1 has also been shown to play a role in hematopoiesis.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality JAG1 Rabbit pAb (APR19373N) .

Synonyms

JAG1; AGS; AGS1; AHD; AWS; CD339; HJ1; JAGL1; jagged 1

Gene ID

182

UniProt

P78504

Cellular Locus

Membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 116kDa/133kDa Observed MW: 180KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=182

Uniprot URL

https://www.uniprot.org/uniprot/P78504

AA Sequence

QFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Dgkb Pre-designed siRNA Set B
SI203744B 1 Each

Rat Dgkb Pre-designed siRNA Set B

Sign In for Pricing
View Details
4-Bromo-2,2-diphenylbutyronitrile (Standard)
HY-W011418R 1 Each

4-Bromo-2,2-diphenylbutyronitrile (Standard)

Sign In for Pricing
View Details
RWDD2A Over-expression Lysate Product
GWB-87481B 0.1 mg

RWDD2A Over-expression Lysate Product

Sign In for Pricing
View Details
RPL4P4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1874608 1.0 µg DNA

RPL4P4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
FOXI3 Human shRNA Plasmid Kit (Locus ID 344167)
TL321260 1 Kit

FOXI3 Human shRNA Plasmid Kit (Locus ID 344167)

Sign In for Pricing
View Details
c-Jun (Phospho-Ser63) DNA-Binding ELISA Kit
TFE-7006 1 Kit

c-Jun (Phospho-Ser63) DNA-Binding ELISA Kit

Sign In for Pricing
View Details