Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB14 Rabbit pAb (APR19371N)

Product Specifications

Background

RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes (Junutula et al., 2004 [PubMed 15004230]) .

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RAB14 Rabbit pAb (APR19371N) .

Synonyms

RAB14; FBP; RAB-14

Gene ID

51552

UniProt

P61106

Cellular Locus

Cytoplasmic side, Cytoplasmic vesicle, Early endosome membrane, Golgi apparatus, Golgi apparatus membrane, Lipid-anchor, Recycling endosome, phagosome, phagosome membrane, trans-Golgi network membrane

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 23kDa Observed MW: 24KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51552

Uniprot URL

https://www.uniprot.org/uniprot/P61106

AA Sequence

ADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Paqr8 activation kit by CRISPRa
GA209791 1 Kit

Mouse Paqr8 activation kit by CRISPRa

Sign In for Pricing
View Details
CDK9 Rabbit Polyclonal Antibody
TA330349 100 µL

CDK9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GNPAT Human Pre-designed siRNA Set A
HY-RS05570 1 Set

GNPAT Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
CCDC140 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0385908 1.0 µg DNA

CCDC140 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
LRIT3 (Leucine-rich Repeat, Immunoglobulin-like Domain and Transmembrane Domain-containing Protein 3, FIGLER4, FLJ44691, MGC120618) (MaxLight 650)
129202-ML650 100 µL

LRIT3 (Leucine-rich Repeat, Immunoglobulin-like Domain and Transmembrane Domain-containing Protein 3, FIGLER4, FLJ44691, MGC120618) (MaxLight 650)

Sign In for Pricing
View Details
IMPDH1P10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1086505 3x 1.0 µg

IMPDH1P10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details