Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tafazzin / TAZ Rabbit pAb (APR19344N)

Product Specifications

Background

This gene encodes a protein that is expressed at high levels in cardiac and skeletal muscle. Mutations in this gene have been associated with a number of clinical disorders including Barth syndrome, dilated cardiomyopathy (DCM), hypertrophic DCM, endocardial fibroelastosis, and left ventricular noncompaction (LVNC) . Multiple transcript variants encoding different isoforms have been described. A long form and a short form of each of these isoforms is produced; the short form lacks a hydrophobic leader sequence and may exist as a cytoplasmic protein rather than being membrane-bound. Other alternatively spliced transcripts have been described but the full-length nature of all these transcripts is not known.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Tafazzin / TAZ Rabbit pAb (APR19344N) .

Synonyms

TAZ; BTHS; CMD3A; EFE; EFE2; G4.5; LVNCX; Taz1; tafazzin

Gene ID

6901

UniProt

Q16635

Cellular Locus

Cytoplasm, Membrane, Single-pass membrane protein, Single-pass membrane protein

Dilution

WB 1:1000 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 25kDa/27kDa/28kDa/29kDa/30kDa/31kDa/33kDa Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6901

Uniprot URL

https://www.uniprot.org/uniprot/Q16635

AA Sequence

NDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQPGR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EXOC3L, CT (EXOC3L1, EXOC3L, Exocyst complex component 3-like protein, Protein Jiangli) (MaxLight 550) discontinued
035267-ML550 100 µL

EXOC3L, CT (EXOC3L1, EXOC3L, Exocyst complex component 3-like protein, Protein Jiangli) (MaxLight 550) discontinued

Sign In for Pricing
View Details
PDE1C (NM_001191059) Human Untagged Clone
SC329425 10 µg

PDE1C (NM_001191059) Human Untagged Clone

Sign In for Pricing
View Details
Srrm1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
45500116 3x 1.0 µg

Srrm1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Human Fucosylation Haptoglobin ELISA Kit
MBS3802340-01 48 Well

Human Fucosylation Haptoglobin ELISA Kit

Sign In for Pricing
View Details
Human Fucosylation Haptoglobin ELISA Kit
MBS3802340-02 96 Well

Human Fucosylation Haptoglobin ELISA Kit

Sign In for Pricing
View Details
Human Fucosylation Haptoglobin ELISA Kit
MBS3802340-03 5x 96 Well

Human Fucosylation Haptoglobin ELISA Kit

Sign In for Pricing
View Details