Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] CD133 Rabbit pAb (APR19334N)

Product Specifications

Background

This gene encodes a pentaspan transmembrane glycoprotein. The protein localizes to membrane protrusions and is often expressed on adult stem cells, where it is thought to function in maintaining stem cell properties by suppressing differentiation. Mutations in this gene have been shown to result in retinitis pigmentosa and Stargardt disease. Expression of this gene is also associated with several types of cancer. This gene is expressed from at least five alternative promoters that are expressed in a tissue-dependent manner. Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] CD133 Rabbit pAb (APR19334N) .

Synonyms

PROM1; AC133; CD133; CORD12; MCDR2; MSTP061; PROML1; RP41; STGD4

Gene ID

8842

UniProt

O43490

Cellular Locus

Apical cell membrane, Cell projection, Endoplasmic reticulum, Endoplasmic reticulum-Golgi intermediate compartment, Multi-pass membrane protein, cilium, microvillus membrane, photoreceptor outer segment

Applications

WB (Mouse Monocyte Macrophage Leukemia Cells, Mus musculus) IF (Homo sapiens)

Dilution

WB 1:1000 - 1:3000 IF 1:50 - 1:200 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 92kDa/93kDa/94kDa/96kDa/97kDa Observed MW: 120KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8842

Uniprot URL

https://www.uniprot.org/uniprot/O43490

AA Sequence

FEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDPLNLFWFGIGKATVFLLPALIFAVKLAKYYRRMDSEDVYDDVETIPMKNMENGNNGYHKDH

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

T-complex Protein 1 theta (T-complex Protein 1 theta Subunit, TCP1 theta, TCP1-theta, TCP-1 theta, Chaperonin Containing TCP1 theta, Chaperonin-containing TCP-1 theta, CCT theta, CCT-theta, CCTQ, Chaperonin Containing TCP1 Subunit 8, Chaperonin-containing
MBS6250233-01 0.1 mL

T-complex Protein 1 theta (T-complex Protein 1 theta Subunit, TCP1 theta, TCP1-theta, TCP-1 theta, Chaperonin Containing TCP1 theta, Chaperonin-containing TCP-1 theta, CCT theta, CCT-theta, CCTQ, Chaperonin Containing TCP1 Subunit 8, Chaperonin-containing

Ask
View Details
T-complex Protein 1 theta (T-complex Protein 1 theta Subunit, TCP1 theta, TCP1-theta, TCP-1 theta, Chaperonin Containing TCP1 theta, Chaperonin-containing TCP-1 theta, CCT theta, CCT-theta, CCTQ, Chaperonin Containing TCP1 Subunit 8, Chaperonin-containing
MBS6250233-02 5x 0.1 mL

T-complex Protein 1 theta (T-complex Protein 1 theta Subunit, TCP1 theta, TCP1-theta, TCP-1 theta, Chaperonin Containing TCP1 theta, Chaperonin-containing TCP-1 theta, CCT theta, CCT-theta, CCTQ, Chaperonin Containing TCP1 Subunit 8, Chaperonin-containing

Ask
View Details
Rabbit Polyclonal RBM46 Antibody
NBP3-17424-25ul 25 µL

Rabbit Polyclonal RBM46 Antibody

Ask
View Details
Mouse Apolipoprotein B (APOB) ELISA Kit-Sandwich
EK5F931-01 48 Test

Mouse Apolipoprotein B (APOB) ELISA Kit-Sandwich

Ask
View Details
Mouse Apolipoprotein B (APOB) ELISA Kit-Sandwich
EK5F931-02 96 Tests

Mouse Apolipoprotein B (APOB) ELISA Kit-Sandwich

Ask
View Details
UQCC1 Antibody
MBS9630451-01 0.1 mL

UQCC1 Antibody

Ask
View Details