Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A2 Rabbit pAb (APR19274N)

Product Specifications

Background

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may have a tumor suppressor function. Chromosomal rearrangements and altered expression of this gene have been implicated in breast cancer.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality S100A2 Rabbit pAb (APR19274N) .

Synonyms

S100A2; CAN19; S100L

Gene ID

6273

UniProt

P29034

Dilution

WB 1:1000 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 11kDa Observed MW: 11-15kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6273

Uniprot URL

https://www.uniprot.org/uniprot/P29034

AA Sequence

MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Avermectin A1b (>85%)
TRC-A847910-2.5MG 2.5 mg

Avermectin A1b (>85%)

Ask
View Details
MED18 (Mediator of RNA Polymerase II Transcription Subunit 18, Mediator Complex Subunit 18, p28b) (MaxLight 550)
MBS6385199-01 0.1 mL

MED18 (Mediator of RNA Polymerase II Transcription Subunit 18, Mediator Complex Subunit 18, p28b) (MaxLight 550)

Ask
View Details
MED18 (Mediator of RNA Polymerase II Transcription Subunit 18, Mediator Complex Subunit 18, p28b) (MaxLight 550)
MBS6385199-02 5x 0.1 mL

MED18 (Mediator of RNA Polymerase II Transcription Subunit 18, Mediator Complex Subunit 18, p28b) (MaxLight 550)

Ask
View Details
Chicken Polyclonal Albumin Antibody [Alexa Fluor 700]
NBP1-77027AF700 0.1 mL

Chicken Polyclonal Albumin Antibody [Alexa Fluor 700]

Ask
View Details
CDS1 (Phosphatidate Cytidylyltransferase 1, CDP-DAG Synthase 1, CDP-DG Synthase 1, CDP-diacylglycerol Synthase 1, CDS 1, CDP-diglyceride Pyrophosphorylase 1, CDP-diglyceride Synthase 1, CTP:phosphatidate Cytidylyltransferase 1, CDS) (Biotin)
MBS6141133-01 0.1 mL

CDS1 (Phosphatidate Cytidylyltransferase 1, CDP-DAG Synthase 1, CDP-DG Synthase 1, CDP-diacylglycerol Synthase 1, CDS 1, CDP-diglyceride Pyrophosphorylase 1, CDP-diglyceride Synthase 1, CTP:phosphatidate Cytidylyltransferase 1, CDS) (Biotin)

Ask
View Details
CDS1 (Phosphatidate Cytidylyltransferase 1, CDP-DAG Synthase 1, CDP-DG Synthase 1, CDP-diacylglycerol Synthase 1, CDS 1, CDP-diglyceride Pyrophosphorylase 1, CDP-diglyceride Synthase 1, CTP:phosphatidate Cytidylyltransferase 1, CDS) (Biotin)
MBS6141133-02 5x 0.1 mL

CDS1 (Phosphatidate Cytidylyltransferase 1, CDP-DAG Synthase 1, CDP-DG Synthase 1, CDP-diacylglycerol Synthase 1, CDS 1, CDP-diglyceride Pyrophosphorylase 1, CDP-diglyceride Synthase 1, CTP:phosphatidate Cytidylyltransferase 1, CDS) (Biotin)

Ask
View Details