Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MICA Rabbit pAb (APR19252N)

Product Specifications

Background

This gene encodes the highly polymorphic major histocompatability complex class I chain-related protein A. The protein product is expressed on the cell surface, although unlike canonical class I molecules it does not seem to associate with beta-2-microglobulin. It is a ligand for the NKG2-D type II integral membrane protein receptor. The protein functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. Variations in this gene have been associated with susceptibility to psoriasis 1 and psoriatic arthritis, and the shedding of MICA-related antibodies and ligands is involved in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma. Alternative splicing of this gene results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MICA Rabbit pAb (APR19252N) .

Synonyms

MICA; MIC-A; PERB11.1

Gene ID

100507436

UniProt

Q29983

Cellular Locus

Cell membrane, Cytoplasm, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 31kDa/42kDa Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=100507436

Uniprot URL

https://www.uniprot.org/uniprot/Q29983

AA Sequence

EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plexin A1 Rabbit pAb, Pacific Blue conjugated
orb2839711 100 µL

Plexin A1 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
TMEM25 (NM_001144036) Human Tagged Lenti ORF Clone
RC227459L4 10 µg

TMEM25 (NM_001144036) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Pantetheinase (VNN1) ELISA Kit
MBS286709-01 48 Tests

Mouse Pantetheinase (VNN1) ELISA Kit

Sign In for Pricing
View Details
Mouse Pantetheinase (VNN1) ELISA Kit
MBS286709-02 96 Tests

Mouse Pantetheinase (VNN1) ELISA Kit

Sign In for Pricing
View Details
Mouse Pantetheinase (VNN1) ELISA Kit
MBS286709-03 5x 96 Tests

Mouse Pantetheinase (VNN1) ELISA Kit

Sign In for Pricing
View Details
Mouse Pantetheinase (VNN1) ELISA Kit
MBS286709-04 10x 96 Tests

Mouse Pantetheinase (VNN1) ELISA Kit

Sign In for Pricing
View Details