Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TDG Rabbit pAb (APR19249N)

Product Specifications

Background

The protein encoded by this gene belongs to the TDG/mug DNA glycosylase family. Thymine-DNA glycosylase (TDG) removes thymine moieties from G/T mismatches by hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of DNA and the mispaired thymine. With lower activity, this enzyme also removes thymine from C/T and T/T mispairings. TDG can also remove uracil and 5-bromouracil from mispairings with guanine. This enzyme plays a central role in cellular defense against genetic mutation caused by the spontaneous deamination of 5-methylcytosine and cytosine. This gene may have a pseudogene in the p arm of chromosome 12.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TDG Rabbit pAb (APR19249N) .

Synonyms

TDG; hTDG

Gene ID

6996

UniProt

Q13569

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 46kDa Observed MW: 60kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6996

Uniprot URL

https://www.uniprot.org/uniprot/Q13569

AA Sequence

MEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVVNEQQMPEEVPAPAPAQEPVQEAPKGRKRKPRTTEPKQPVEPKKPVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFRA1 Antibody
orb1178241 100 µg

GFRA1 Antibody

Sign In for Pricing
View Details
DDB1 (DNA Damage-binding Protein 1, DDB p127 Subunit, DNA Damage-binding Protein a, DDBa, Damage-specific DNA-binding Protein 1, HBV X-associated Protein 1, XAP-1, UV-damaged DNA-binding Factor, UV-damaged DNA-binding Protein 1, UV-DDB 1, XPE-binding Factor, XPE-BF, Xeroderma pigmentosum Group E-complementing Protein, XPCe, XAP1) (MaxLight 490)
125700-ML490 100 µL

DDB1 (DNA Damage-binding Protein 1, DDB p127 Subunit, DNA Damage-binding Protein a, DDBa, Damage-specific DNA-binding Protein 1, HBV X-associated Protein 1, XAP-1, UV-damaged DNA-binding Factor, UV-damaged DNA-binding Protein 1, UV-DDB 1, XPE-binding Factor, XPE-BF, Xeroderma pigmentosum Group E-complementing Protein, XPCe, XAP1) (MaxLight 490)

Sign In for Pricing
View Details
BDKRB1 Polyclonal Antibody, Biotin Conjugated
bs-8675R-Biotin 100 µL

BDKRB1 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
CEA Antibody / CEACAM5
V9003-100UG 100 µg

CEA Antibody / CEACAM5

Sign In for Pricing
View Details
CINP (NM_032630) Human Tagged ORF Clone Lentiviral Particle
RC200085L2V 200 µL

CINP (NM_032630) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse SLC9A1 siRNA
abx934172-01 15 nmol

Mouse SLC9A1 siRNA

Sign In for Pricing
View Details