Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gm13125 Rabbit pAb (APR19248N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Gm13125 Rabbit pAb (APR19248N) .

Synonyms

PRAMEF20; PRAMEF21; Gm13125

Gene ID

627009

UniProt

Q5VT98

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 55kDa Observed MW: 55kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=627009

Uniprot URL

https://www.uniprot.org/uniprot/Q5VT98

AA Sequence

MSSKPLLTLQELAAQNILRNEALAISALQYLPELFLPQLLKQAYDGNHLKVLRAIVSSWPFPRLPLGALKKRTPYLETQLQVVLEEVDKLLIQEVHPREYKLEVLDLRSVGQNYLNVWPGAMDDWLPKTTQTDPCCSKTVMTQPLKVLVDLQLNNRGQSRLFSYLVQWSDRRKGLLQLYCNKLQIWSPSQQNYRKLSQKVNLDYVETLGLHSSCSPSFLLNFAPYLRQMRNLRKLALSNIREEHIISPEKRRCIITRFTLQILKLESLQKLHLDAVCFLEGHLDQLLGSVKTSLDELAVTHCNLSVSEWSHFSEFPCVSQLQQLNLENVRLTGLSPEPLQVLLVKAGPTLVALDLEDCHLEDGQLYAILPALSKCFKLTKFSFYGNQISMLAMKDLLHHTASLIHLRLELYPVPQDSYDYHGTPLMQRMQQHCDELMNLLKTFRNPGRVFFGTDRCDQCCNRYIYNKTIMCNCRRSY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C21orf77 sgRNA CRISPR Lentivector set (Human)
K0341501 3x 1.0 µg

C21orf77 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Actin, alpha skeletal muscle Monoclonal Antibody, Cy7 Conjugated
bsm-33308M-Cy7-01 20 µL

Actin, alpha skeletal muscle Monoclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Actin, alpha skeletal muscle Monoclonal Antibody, Cy7 Conjugated
bsm-33308M-Cy7-02 100 µL

Actin, alpha skeletal muscle Monoclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Lentiviral human GPR33 shRNA (UAS) - Lentiviral human GPR33 shRNA (UAS, GFP) (25)
GTR15336263 1 Vial

Lentiviral human GPR33 shRNA (UAS) - Lentiviral human GPR33 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Mouse Monoclonal EVA1/MPZL2 Antibody (OTI2C7) [Alexa Fluor 594]
NBP2-71553AF594 0.1 mL

Mouse Monoclonal EVA1/MPZL2 Antibody (OTI2C7) [Alexa Fluor 594]

Sign In for Pricing
View Details
Amodiaquine discontinued
A1460 100 µL

Amodiaquine discontinued

Sign In for Pricing
View Details