Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gm13125 Rabbit pAb (APR19248N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Gm13125 Rabbit pAb (APR19248N) .

Synonyms

PRAMEF20; PRAMEF21; Gm13125

Gene ID

627009

UniProt

Q5VT98

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 55kDa Observed MW: 55kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=627009

Uniprot URL

https://www.uniprot.org/uniprot/Q5VT98

AA Sequence

MSSKPLLTLQELAAQNILRNEALAISALQYLPELFLPQLLKQAYDGNHLKVLRAIVSSWPFPRLPLGALKKRTPYLETQLQVVLEEVDKLLIQEVHPREYKLEVLDLRSVGQNYLNVWPGAMDDWLPKTTQTDPCCSKTVMTQPLKVLVDLQLNNRGQSRLFSYLVQWSDRRKGLLQLYCNKLQIWSPSQQNYRKLSQKVNLDYVETLGLHSSCSPSFLLNFAPYLRQMRNLRKLALSNIREEHIISPEKRRCIITRFTLQILKLESLQKLHLDAVCFLEGHLDQLLGSVKTSLDELAVTHCNLSVSEWSHFSEFPCVSQLQQLNLENVRLTGLSPEPLQVLLVKAGPTLVALDLEDCHLEDGQLYAILPALSKCFKLTKFSFYGNQISMLAMKDLLHHTASLIHLRLELYPVPQDSYDYHGTPLMQRMQQHCDELMNLLKTFRNPGRVFFGTDRCDQCCNRYIYNKTIMCNCRRSY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

pEGFP-LC3B-p Plasmid
PVT1505 2 µg

pEGFP-LC3B-p Plasmid

Request Quote
View Details
Akr1c20 (BC021607) Mouse Tagged ORF Clone Lentiviral Particle
MR204690L4V 200 µL

Akr1c20 (BC021607) Mouse Tagged ORF Clone Lentiviral Particle

Request Quote
View Details
PQBP1 (NM_144495) Human Tagged Lenti ORF Clone
RC229628L3 10 µg

PQBP1 (NM_144495) Human Tagged Lenti ORF Clone

Request Quote
View Details
Eltrombopag Methyl Ester
164011 5 mg

Eltrombopag Methyl Ester

Request Quote
View Details
GOLGA5 (Golgin Subfamily A Member 5, Cell Proliferation-inducing Gene 31 Protein, Golgin-84, Protein Ret-II, RET-fused Gene 5 Protein, RETII, RFG5, PIG31) APC
MBS6380122-01 0.1 mL

GOLGA5 (Golgin Subfamily A Member 5, Cell Proliferation-inducing Gene 31 Protein, Golgin-84, Protein Ret-II, RET-fused Gene 5 Protein, RETII, RFG5, PIG31) APC

Request Quote
View Details
GOLGA5 (Golgin Subfamily A Member 5, Cell Proliferation-inducing Gene 31 Protein, Golgin-84, Protein Ret-II, RET-fused Gene 5 Protein, RETII, RFG5, PIG31) APC
MBS6380122-02 5x 0.1 mL

GOLGA5 (Golgin Subfamily A Member 5, Cell Proliferation-inducing Gene 31 Protein, Golgin-84, Protein Ret-II, RET-fused Gene 5 Protein, RETII, RFG5, PIG31) APC

Request Quote
View Details