Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gm13125 Rabbit pAb (APR19248N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Gm13125 Rabbit pAb (APR19248N) .

Synonyms

PRAMEF20; PRAMEF21; Gm13125

Gene ID

627009

UniProt

Q5VT98

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 55kDa Observed MW: 55kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=627009

Uniprot URL

https://www.uniprot.org/uniprot/Q5VT98

AA Sequence

MSSKPLLTLQELAAQNILRNEALAISALQYLPELFLPQLLKQAYDGNHLKVLRAIVSSWPFPRLPLGALKKRTPYLETQLQVVLEEVDKLLIQEVHPREYKLEVLDLRSVGQNYLNVWPGAMDDWLPKTTQTDPCCSKTVMTQPLKVLVDLQLNNRGQSRLFSYLVQWSDRRKGLLQLYCNKLQIWSPSQQNYRKLSQKVNLDYVETLGLHSSCSPSFLLNFAPYLRQMRNLRKLALSNIREEHIISPEKRRCIITRFTLQILKLESLQKLHLDAVCFLEGHLDQLLGSVKTSLDELAVTHCNLSVSEWSHFSEFPCVSQLQQLNLENVRLTGLSPEPLQVLLVKAGPTLVALDLEDCHLEDGQLYAILPALSKCFKLTKFSFYGNQISMLAMKDLLHHTASLIHLRLELYPVPQDSYDYHGTPLMQRMQQHCDELMNLLKTFRNPGRVFFGTDRCDQCCNRYIYNKTIMCNCRRSY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Borna disease viruses 2 PCR kit
PCR-V628-96R 100T

Borna disease viruses 2 PCR kit

Sign In for Pricing
View Details
TFDP1 (Transcription Factor Dp-1, DRTF1-Polypeptide 1, DRTF1, E2F dimerization Partner 1, TFDP1, DP1) discontinued
226272-01 50 µL

TFDP1 (Transcription Factor Dp-1, DRTF1-Polypeptide 1, DRTF1, E2F dimerization Partner 1, TFDP1, DP1) discontinued

Sign In for Pricing
View Details
TFDP1 (Transcription Factor Dp-1, DRTF1-Polypeptide 1, DRTF1, E2F dimerization Partner 1, TFDP1, DP1) discontinued
226272-02 100 µL

TFDP1 (Transcription Factor Dp-1, DRTF1-Polypeptide 1, DRTF1, E2F dimerization Partner 1, TFDP1, DP1) discontinued

Sign In for Pricing
View Details
Goat Anti-Rabbit IgG (H+L), Mouse/Rat/Human ads-AP
4049-04 1.0 mL

Goat Anti-Rabbit IgG (H+L), Mouse/Rat/Human ads-AP

Sign In for Pricing
View Details
Anti-Human ZNF500 Antibody (C257)
HT283013-01 50 µg

Anti-Human ZNF500 Antibody (C257)

Sign In for Pricing
View Details
Anti-Human ZNF500 Antibody (C257)
HT283013-02 100 µg

Anti-Human ZNF500 Antibody (C257)

Sign In for Pricing
View Details