Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAL1 Rabbit pAb (APR19230N)

Product Specifications

Background

This gene encodes an axonemal dynein light chain which functions as a component of the outer dynein arms complex. This complex acts as the molecular motor that provides the force to move cilia in an ATP-dependent manner. The encoded protein is expressed in tissues with motile cilia or flagella and may be involved in the movement of sperm flagella. Alternate splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DNAL1 Rabbit pAb (APR19230N) .

Synonyms

DNAL1; C14orf168; CILD16

Gene ID

83544

UniProt

Q4LDG9

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 8kDa/17kDa/21kDa Observed MW: 22kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=83544

Uniprot URL

https://www.uniprot.org/uniprot/Q4LDG9

AA Sequence

DASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDEEEDN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Cadherin 16 (CDH16) ELISA kit
GTR10371650 96 Well

Goat Cadherin 16 (CDH16) ELISA kit

Sign In for Pricing
View Details
Col14a1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3394302 1.0 µg DNA

Col14a1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1792 (AF_1792)
MBS7036460-01 0.02 mg

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1792 (AF_1792)

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1792 (AF_1792)
MBS7036460-02 0.1 mg

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1792 (AF_1792)

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1792 (AF_1792)
MBS7036460-03 5x 0.1 mg

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1792 (AF_1792)

Sign In for Pricing
View Details
Mouse Park2 / E3 ubiquitin-protein ligase parkin Recombinant Protein
R2353m 1 Each

Mouse Park2 / E3 ubiquitin-protein ligase parkin Recombinant Protein

Sign In for Pricing
View Details