Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UHRF1 Rabbit pAb (APR19218N)

Product Specifications

Background

This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. It is regarded as a hub protein for the integration of epigenetic information. This gene is up-regulated in various cancers, and it is therefore considered to be a therapeutic target. Multiple transcript variants encoding different isoforms have been found for this gene. A related pseudogene exists on chromosome 12.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality UHRF1 Rabbit pAb (APR19218N) .

Synonyms

UHRF1; ICBP90; Np95; RNF106; TDRD22; hNP95; hUHRF1; huNp95

Gene ID

29128

UniProt

Q96T88

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 89kDa/91kDa Observed MW: 90kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=29128

Uniprot URL

https://www.uniprot.org/uniprot/Q96T88

AA Sequence

MWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (2,6-Diethylphenyl) -1H-imidazole
ABA36442-01 250 mg

1- (2,6-Diethylphenyl) -1H-imidazole

Sign In for Pricing
View Details
1- (2,6-Diethylphenyl) -1H-imidazole
ABA36442-02 2.5 g

1- (2,6-Diethylphenyl) -1H-imidazole

Sign In for Pricing
View Details
Mouse Vitamin D3 (VD3) ELISA Kit
GA-E0470MS-01 48 Tests

Mouse Vitamin D3 (VD3) ELISA Kit

Sign In for Pricing
View Details
Mouse Vitamin D3 (VD3) ELISA Kit
GA-E0470MS-02 96 Tests

Mouse Vitamin D3 (VD3) ELISA Kit

Sign In for Pricing
View Details
5-Chloro-2-cyanopyrazine
sc-262575A 5 g

5-Chloro-2-cyanopyrazine

Sign In for Pricing
View Details
TOX2 (NM_001098798) Human Tagged ORF Clone Lentiviral Particle
RC211625L4V 200 µL

TOX2 (NM_001098798) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details