Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UHRF1 Rabbit pAb (APR19218N)

Product Specifications

Background

This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. It is regarded as a hub protein for the integration of epigenetic information. This gene is up-regulated in various cancers, and it is therefore considered to be a therapeutic target. Multiple transcript variants encoding different isoforms have been found for this gene. A related pseudogene exists on chromosome 12.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality UHRF1 Rabbit pAb (APR19218N) .

Synonyms

UHRF1; ICBP90; Np95; RNF106; TDRD22; hNP95; hUHRF1; huNp95

Gene ID

29128

UniProt

Q96T88

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 89kDa/91kDa Observed MW: 90kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=29128

Uniprot URL

https://www.uniprot.org/uniprot/Q96T88

AA Sequence

MWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Heptynoic Acid
TRC-H265710-1G 1 g

6-Heptynoic Acid

Sign In for Pricing
View Details
CTPS Rabbit Polyclonal Antibody
orb579652 100 µL

CTPS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ligupurpuroside C
HY-N2089 1 Each

Ligupurpuroside C

Sign In for Pricing
View Details
PerCP Anti-human CD7 Antibody *HIT7*
100701T0-AAT 25 Tests

PerCP Anti-human CD7 Antibody *HIT7*

Sign In for Pricing
View Details
Conductin CRISPR Activation Plasmid (m2)
sc-419278-ACT-2 20 µg

Conductin CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
TSSK6 Protein Lysate (Human) with C-Ha Tag
48652031 100 µg

TSSK6 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details