Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UHRF1 Rabbit pAb (APR19218N)

Product Specifications

Background

This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. It is regarded as a hub protein for the integration of epigenetic information. This gene is up-regulated in various cancers, and it is therefore considered to be a therapeutic target. Multiple transcript variants encoding different isoforms have been found for this gene. A related pseudogene exists on chromosome 12.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality UHRF1 Rabbit pAb (APR19218N) .

Synonyms

UHRF1; ICBP90; Np95; RNF106; TDRD22; hNP95; hUHRF1; huNp95

Gene ID

29128

UniProt

Q96T88

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 89kDa/91kDa Observed MW: 90kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=29128

Uniprot URL

https://www.uniprot.org/uniprot/Q96T88

AA Sequence

MWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clivorine
T30970 25 mg

Clivorine

Sign In for Pricing
View Details
LBX1 (ladybird Homeobox 1, HPX-6, HPX6, LBX1H, Homeobox) (PE)
MBS6185506-01 0.1 mL

LBX1 (ladybird Homeobox 1, HPX-6, HPX6, LBX1H, Homeobox) (PE)

Sign In for Pricing
View Details
LBX1 (ladybird Homeobox 1, HPX-6, HPX6, LBX1H, Homeobox) (PE)
MBS6185506-02 5x 0.1 mL

LBX1 (ladybird Homeobox 1, HPX-6, HPX6, LBX1H, Homeobox) (PE)

Sign In for Pricing
View Details
SLC36A1 Adenovirus (Human)
44158051 1.0 mL

SLC36A1 Adenovirus (Human)

Sign In for Pricing
View Details
A530013C23Rik Mouse shRNA Lentiviral Particle (Locus ID 329562)
TL516413V 500 µL Each

A530013C23Rik Mouse shRNA Lentiviral Particle (Locus ID 329562)

Sign In for Pricing
View Details
Porcine Malate dehydrogenase (MDH) ELISA Kit
YP-W80743-01 48 Tests

Porcine Malate dehydrogenase (MDH) ELISA Kit

Sign In for Pricing
View Details