Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UQCR10 Rabbit pAb (APR19216N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality UQCR10 Rabbit pAb (APR19216N) .

Synonyms

UQCR10; HSPC051; HSPC119; HSPC151; QCR9; UCCR7.2; UCRC

Gene ID

29796

UniProt

Q9UDW1

Cellular Locus

Mitochondrion inner membrane

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 6kDa/7kDa Observed MW: 10kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=29796

Uniprot URL

https://www.uniprot.org/uniprot/Q9UDW1

AA Sequence

MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Spast Pre-designed siRNA Set B
SI113650B 1 Each

Mouse Spast Pre-designed siRNA Set B

Sign In for Pricing
View Details
TCTA CRISPRa sgRNA lentivector (set of three targets)(Rat)
46424126 3x 1.0µg DNA

TCTA CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Salmonella species (A,B,C,D,E,F and G groups) (MaxLight 650)
MBS6220258-01 0.1 mL

Salmonella species (A,B,C,D,E,F and G groups) (MaxLight 650)

Sign In for Pricing
View Details
Salmonella species (A,B,C,D,E,F and G groups) (MaxLight 650)
MBS6220258-02 5x 0.1 mL

Salmonella species (A,B,C,D,E,F and G groups) (MaxLight 650)

Sign In for Pricing
View Details
Chlormadinone Acetate-13C2,d3
TRC-C343501-1MG 1 mg

Chlormadinone Acetate-13C2,d3

Sign In for Pricing
View Details
ZO-1 Polyclonal Antibody, FITC Conjugated
bs-41327R-FITC 100 µL

ZO-1 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details