Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TUSC3 Rabbit pAb (APR19201N)

Product Specifications

Background

This gene is a candidate tumor suppressor gene. It is located within a homozygously deleted region of a metastatic prostate cancer. The gene is expressed in most nonlymphoid human tissues including prostate, lung, liver, and colon. Expression was also detected in many epithelial tumor cell lines. Two transcript variants encoding distinct isoforms have been identified for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TUSC3 Rabbit pAb (APR19201N) .

Synonyms

TUSC3; D8S1992; M33; MRT22; MRT7; N33; OST3A

Gene ID

7991

UniProt

Q13454

Cellular Locus

Endoplasmic reticulum membrane, Multi-pass membrane protein

Applications

WB (Homo sapiens) IF (Homo sapiens)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 39kDa Observed MW: 38kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7991

Uniprot URL

https://www.uniprot.org/uniprot/Q13454

AA Sequence

QKKKENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFIKAPPRNYSMIVMFTALQPQRQCSVCRQANEEYQILANSWRYSSAFCNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFPPKGRPKRADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Streptomyces griseus subsp. griseus Ribonuclease P protein component (rnpA)
MBS1014956-01 0.02 mg (E-Coli)

Recombinant Streptomyces griseus subsp. griseus Ribonuclease P protein component (rnpA)

Sign In for Pricing
View Details
Recombinant Streptomyces griseus subsp. griseus Ribonuclease P protein component (rnpA)
MBS1014956-02 0.1 mg (E-Coli)

Recombinant Streptomyces griseus subsp. griseus Ribonuclease P protein component (rnpA)

Sign In for Pricing
View Details
Recombinant Streptomyces griseus subsp. griseus Ribonuclease P protein component (rnpA)
MBS1014956-03 0.02 mg (Yeast)

Recombinant Streptomyces griseus subsp. griseus Ribonuclease P protein component (rnpA)

Sign In for Pricing
View Details
Recombinant Streptomyces griseus subsp. griseus Ribonuclease P protein component (rnpA)
MBS1014956-04 0.1 mg (Yeast)

Recombinant Streptomyces griseus subsp. griseus Ribonuclease P protein component (rnpA)

Sign In for Pricing
View Details
Recombinant Streptomyces griseus subsp. griseus Ribonuclease P protein component (rnpA)
MBS1014956-05 0.02 mg (Baculovirus)

Recombinant Streptomyces griseus subsp. griseus Ribonuclease P protein component (rnpA)

Sign In for Pricing
View Details
Recombinant Streptomyces griseus subsp. griseus Ribonuclease P protein component (rnpA)
MBS1014956-06 0.02 mg (Mammalian-Cell)

Recombinant Streptomyces griseus subsp. griseus Ribonuclease P protein component (rnpA)

Sign In for Pricing
View Details