Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HDAC3 Rabbit pAb (APR19171N)

Product Specifications

Background

Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. It may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. This protein can also down-regulate p53 function and thus modulate cell growth and apoptosis. This gene is regarded as a potential tumor suppressor gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HDAC3 Rabbit pAb (APR19171N) .

Synonyms

HD3; RPD3; RPD3-2; HDAC3

Gene ID

8841

UniProt

O15379

Cellular Locus

Cytoplasm, Nucleus, cytosol

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 48kDa/49kDa Observed MW: 48kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8841

Uniprot URL

https://www.uniprot.org/uniprot/O15379

AA Sequence

EYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human c-Yes/YES1 Protein (His & GST Tag)
PKSH030348 50 µg

Recombinant Human c-Yes/YES1 Protein (His & GST Tag)

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2685), CF488A conjugate, 0.1mg/mL
BNC882685-500 1x 500 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2685), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ANKRD36B Human Gene Knockout Kit (CRISPR)
KN424876 1 Kit

ANKRD36B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PFKL Rabbit Polyclonal Antibody
AP06677PU-N 100 µg

PFKL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RGS3 (NM_134427) Human Recombinant Protein
TP306471 20 µg

RGS3 (NM_134427) Human Recombinant Protein

Sign In for Pricing
View Details
3-Bromo-2-hydroxybenzoic Acid
TRC-B687620-25G 25 g

3-Bromo-2-hydroxybenzoic Acid

Sign In for Pricing
View Details