Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WISP2 Rabbit pAb (APR19170N)

Product Specifications

Background

This gene encodes a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate diverse developmental processes. The CTGF family members are characterized by four conserved cysteine-rich domains: insulin-like growth factor-binding domain, von Willebrand factor type C module, thrombospondin domain and C-terminal cystine knot-like (CT) domain. The encoded protein lacks the CT domain which is implicated in dimerization and heparin binding. It is 72% identical to the mouse protein at the amino acid level. This gene may be downstream in the WNT1 signaling pathway that is relevant to malignant transformation. Its expression in colon tumors is reduced while the other two WISP members are overexpressed in colon tumors. It is expressed at high levels in bone tissue, and may play an important role in modulating bone turnover.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality WISP2 Rabbit pAb (APR19170N) .

Synonyms

WISP2; CCN5; CT58; CTGF-L

Gene ID

8839

UniProt

O76076

Cellular Locus

Secreted

Applications

WB (Rattus norvegicus) IF (Rattus norvegicus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 22kDa/26kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8839

Uniprot URL

https://www.uniprot.org/uniprot/O76076

AA Sequence

VEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BBS7 Protein Vector (Human) (pPB-C-His)
PV003565 500 ng

BBS7 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Phospho-p70 S6 Kinase (Thr389/412) Antibody
E18-3228-2 100 µg -100 µL

Phospho-p70 S6 Kinase (Thr389/412) Antibody

Sign In for Pricing
View Details
SH3KBP1 (NM_031892) Human Tagged ORF Clone Lentiviral Particle
RC202186L1V 200 µL

SH3KBP1 (NM_031892) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CD3 Antibody (PE / Cyanine 5.5)
abx228199-01 50 Tests

CD3 Antibody (PE / Cyanine 5.5)

Sign In for Pricing
View Details
CD3 Antibody (PE / Cyanine 5.5)
abx228199-02 100 Tests

CD3 Antibody (PE / Cyanine 5.5)

Sign In for Pricing
View Details
CD3 Antibody (PE / Cyanine 5.5)
abx228199-03 100 µg

CD3 Antibody (PE / Cyanine 5.5)

Sign In for Pricing
View Details