Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCEB1 Rabbit pAb (APR19143N)

Product Specifications

Background

This gene encodes the protein elongin C, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Multiple alternatively spliced transcript variants encoding two distinct isoforms have been identified.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TCEB1 Rabbit pAb (APR19143N) .

Synonyms

ELOC; SIII; TCEB1; eloC; elongin-C

Gene ID

6921

UniProt

Q15369

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 10kDa/12kDa Observed MW: 12kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6921

Uniprot URL

https://www.uniprot.org/uniprot/Q15369

AA Sequence

MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Mouse Complement Component 1 Q Subcomponent A (C1qA) Polyclonal Antibody
VD4N154 1 Each

Rabbit Anti-Mouse Complement Component 1 Q Subcomponent A (C1qA) Polyclonal Antibody

Sign In for Pricing
View Details
ARRDC5, NT (ARRDC5, Arrestin domain-containing protein 5) (PE)
MBS6275390-01 0.2 mL

ARRDC5, NT (ARRDC5, Arrestin domain-containing protein 5) (PE)

Sign In for Pricing
View Details
ARRDC5, NT (ARRDC5, Arrestin domain-containing protein 5) (PE)
MBS6275390-02 5x 0.2 mL

ARRDC5, NT (ARRDC5, Arrestin domain-containing protein 5) (PE)

Sign In for Pricing
View Details
Human MPI siRNA
abx903311-01 15 nmol

Human MPI siRNA

Sign In for Pricing
View Details
Human MPI siRNA
abx903311-02 30 nmol

Human MPI siRNA

Sign In for Pricing
View Details
Human Activating Transcription Factor 3 (ATF3) ELISA Kit
RDR-ATF3-Hu-48Tests 48 Tests

Human Activating Transcription Factor 3 (ATF3) ELISA Kit

Sign In for Pricing
View Details