Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLDN11 Rabbit pAb (APR19106N)

Product Specifications

Background

This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. The protein encoded by this gene is a major component of central nervous system (CNS) myelin and plays an important role in regulating proliferation and migration of oligodendrocytes. Mouse studies showed that the gene deficiency results in deafness and loss of the Sertoli cell epithelial phenotype in the testis. This protein is a tight junction protein at the human blood-testis barrier (BTB), and the BTB disruption is related to a dysfunction of this gene. Alternatively spliced transcript variants encoding different isoforms have been identified.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CLDN11 Rabbit pAb (APR19106N) .

Synonyms

CLDN11; OSP; OTM

Gene ID

5010

UniProt

O75508

Cellular Locus

Cell junction, Cell membrane, Multi-pass membrane protein, tight junction

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 21kDa Observed MW: 23kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5010

Uniprot URL

https://www.uniprot.org/uniprot/O75508

AA Sequence

MVATCLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMATGLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tbc1d15 3'UTR Luciferase Stable Cell Line
TU120195 1.0 mL

Tbc1d15 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
HDAC4, CT (HDAC4, KIAA0288, Histone deacetylase 4) (Azide free) (HRP)
MBS6305915-01 0.2 mL

HDAC4, CT (HDAC4, KIAA0288, Histone deacetylase 4) (Azide free) (HRP)

Sign In for Pricing
View Details
HDAC4, CT (HDAC4, KIAA0288, Histone deacetylase 4) (Azide free) (HRP)
MBS6305915-02 5x 0.2 mL

HDAC4, CT (HDAC4, KIAA0288, Histone deacetylase 4) (Azide free) (HRP)

Sign In for Pricing
View Details
N- (3,5-dichlorophenyl) -1-phenylcyclopentane-1-carboxamide
XQB45512 250 mg

N- (3,5-dichlorophenyl) -1-phenylcyclopentane-1-carboxamide

Sign In for Pricing
View Details
Anti-Alpha-synuclein Antibody (Cinpanemab)
F1541-50 50 mg

Anti-Alpha-synuclein Antibody (Cinpanemab)

Sign In for Pricing
View Details
FOXP3 Rabbit monoclonal antibody
orb2298030-01 25 µL

FOXP3 Rabbit monoclonal antibody

Sign In for Pricing
View Details