Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNJ3 Rabbit pAb (APR19085N)

Product Specifications

Background

Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins and plays an important role in regulating heartbeat. It associates with three other G-protein-activated potassium channels to form a heteromultimeric pore-forming complex that also couples to neurotransmitter receptors in the brain and whereby channel activation can inhibit action potential firing by hyperpolarizing the plasma membrane. These multimeric G-protein-gated inwardly-rectifying potassium (GIRK) channels may play a role in the pathophysiology of epilepsy, addiction, Down's syndrome, ataxia, and Parkinson's disease. Alternative splicing results in multiple transcript variants encoding distinct proteins.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KCNJ3 Rabbit pAb (APR19079N5) .

Synonyms

KCNJ3; GIRK1; KGA; KIR3.1

Gene ID

3760

UniProt

P48549

Cellular Locus

Membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 26kDa/56kDa Observed MW: 60kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3760

Uniprot URL

https://www.uniprot.org/uniprot/P48549

AA Sequence

NGRCNVQHGNLGSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNYTPCVANVYNFPSAFLFFIETEATIGYGYRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC/Fire™ 750 anti-human CD147
GT08508 100 Tests

APC/Fire™ 750 anti-human CD147

Sign In for Pricing
View Details
EZH1 antibody - N-terminal region
MBS3201945-01 0.1 mL

EZH1 antibody - N-terminal region

Sign In for Pricing
View Details
EZH1 antibody - N-terminal region
MBS3201945-02 5x 0.1 mL

EZH1 antibody - N-terminal region

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to Superoxide Dismutase 3, Extracellular (SOD3)
MBS2128447-01 0.1 mL

PE Linked Monoclonal Antibody to Superoxide Dismutase 3, Extracellular (SOD3)

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to Superoxide Dismutase 3, Extracellular (SOD3)
MBS2128447-02 0.2 mL

PE Linked Monoclonal Antibody to Superoxide Dismutase 3, Extracellular (SOD3)

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to Superoxide Dismutase 3, Extracellular (SOD3)
MBS2128447-03 0.5 mL

PE Linked Monoclonal Antibody to Superoxide Dismutase 3, Extracellular (SOD3)

Sign In for Pricing
View Details