Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Granulin Rabbit pAb (APR19069N)

Product Specifications

Background

Granulins are a family of secreted, glycosylated peptides that are cleaved from a single precursor protein with 7.5 repeats of a highly conserved 12-cysteine granulin/epithelin motif. The 88 kDa precursor protein, progranulin, is also called proepithelin and PC cell-derived growth factor. Cleavage of the signal peptide produces mature granulin which can be further cleaved into a variety of active, 6 kDa peptides. These smaller cleavage products are named granulin A, granulin B, granulin C, etc. Epithelins 1 and 2 are synonymous with granulins A and B, respectively. Both the peptides and intact granulin protein regulate cell growth. However, different members of the granulin protein family may act as inhibitors, stimulators, or have dual actions on cell growth. Granulin family members are important in normal development, wound healing, and tumorigenesis.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Granulin Rabbit pAb (APR19069N) .

Synonyms

GRN; CLN11; GEP; GP88; PCDGF; PEPI; PGRN; granulins

Gene ID

2896

UniProt

P28799

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 44kDa/46kDa/63kDa Observed MW: 88KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2896

Uniprot URL

https://www.uniprot.org/uniprot/P28799

AA Sequence

DVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCE

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FITC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1B (LRP1B)
MBS2070055-01 0.1 mL

FITC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1B (LRP1B)

Ask
View Details
FITC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1B (LRP1B)
MBS2070055-02 0.2 mL

FITC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1B (LRP1B)

Ask
View Details
FITC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1B (LRP1B)
MBS2070055-03 0.5 mL

FITC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1B (LRP1B)

Ask
View Details
FITC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1B (LRP1B)
MBS2070055-04 1 mL

FITC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1B (LRP1B)

Ask
View Details
FITC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1B (LRP1B)
MBS2070055-05 5 mL

FITC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1B (LRP1B)

Ask
View Details
FITC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1B (LRP1B)
MBS2070055-06 5x 5 mL

FITC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1B (LRP1B)

Ask
View Details