Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS1 Rabbit pAb (APR19048N)

Product Specifications

Background

This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is secreted by the pancreas and cleaved to its active form in the small intestine. It is active on peptide linkages involving the carboxyl group of lysine or arginine. Mutations in this gene are associated with hereditary pancreatitis. This gene and several other trypsinogen genes are localized to the T cell receptor beta locus on chromosome 7.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PRSS1 Rabbit pAb (APR19048N) .

Synonyms

PRSS1; TRP1; TRY1; TRY4; TRYP1; trypsin-1

Gene ID

5644

UniProt

P07477

Cellular Locus

Secreted, extracellular space

Applications

WB (Homo sapiens, Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:100 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 26kDa Observed MW: 35kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5644

Uniprot URL

https://www.uniprot.org/uniprot/P07477

AA Sequence

IVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Borrelia Duttonii rplC Protein (aa 1-209)
VAng-Lsx1942-50gEcoli 50 µg (E. coli)

Recombinant Borrelia Duttonii rplC Protein (aa 1-209)

Sign In for Pricing
View Details
Human GMPPA Knockout HEK293T cell line
GTR15411978 1 Vial

Human GMPPA Knockout HEK293T cell line

Sign In for Pricing
View Details
GDF7 (Growth Differentiation Factor 7, BMP12) (HRP)
246544-HRP 100 µL

GDF7 (Growth Differentiation Factor 7, BMP12) (HRP)

Sign In for Pricing
View Details
HS Taq PCR Mix
APL3015.200 2000 Reactions

HS Taq PCR Mix

Sign In for Pricing
View Details
Rabbit Polyclonal WDR11 Antibody
NBP1-41103 0.1 mL

Rabbit Polyclonal WDR11 Antibody

Sign In for Pricing
View Details
Rat Carbonic anhydrase 3,CA3 ELISA KIT
JOT-EK1893Ra 96 wells

Rat Carbonic anhydrase 3,CA3 ELISA KIT

Sign In for Pricing
View Details