Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3E Antigen Rabbit pAb (APR19045N)

Product Specifications

Background

The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD3E Antigen Rabbit pAb (APR19045N) .

Synonyms

CD3E; IMD18; T3E; TCRE; CD3e molecule

Gene ID

916

UniProt

P07766

Cellular Locus

Cell membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 23kDa Observed MW: 23KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=916

Uniprot URL

https://www.uniprot.org/uniprot/P07766

AA Sequence

PRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM108 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
46864111 3x 1.0 µg

TMEM108 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
GENLISA™ Human Anti-Haemophilus influenzae Type b ELISA
KBH4289 1x 96 Well

GENLISA™ Human Anti-Haemophilus influenzae Type b ELISA

Sign In for Pricing
View Details
IGHD Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-15573R-BF647 100 µL

IGHD Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Urea, suitable for molecular biology
GE1210-1kg 1 Kg

Urea, suitable for molecular biology

Sign In for Pricing
View Details
IKZF5 Antibody - C-terminal region
MBS3220094-01 0.1 mL

IKZF5 Antibody - C-terminal region

Sign In for Pricing
View Details
IKZF5 Antibody - C-terminal region
MBS3220094-02 5x 0.1 mL

IKZF5 Antibody - C-terminal region

Sign In for Pricing
View Details