Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD59 Rabbit pAb (APR19042N)

Product Specifications

Background

This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD59 Rabbit pAb (APR19042N) .

Synonyms

CD59; 16.3A5; 1F5; EJ16; EJ30; EL32; G344; HRF-20; HRF20; MAC-IP; MACIF; MEM43; MIC11; MIN1; MIN2; MIN3; MIRL; MSK21; p18-20

Gene ID

966

UniProt

P13987

Cellular Locus

Cell membrane, GPI-anchor, Lipid-anchor, Secreted

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 14kDa Observed MW: 14kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=966

Uniprot URL

https://www.uniprot.org/uniprot/P13987

AA Sequence

LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1219 (NM_146899) Mouse Untagged Clone
MC214032 10 µg

Olfr1219 (NM_146899) Mouse Untagged Clone

Sign In for Pricing
View Details
L (+)-Homoarginine hydrochloride
MBS579863 Inquire

L (+)-Homoarginine hydrochloride

Sign In for Pricing
View Details
4- (Benzyloxy) -3-ethoxybenzaldehyde
OR7894-01 250 mg

4- (Benzyloxy) -3-ethoxybenzaldehyde

Sign In for Pricing
View Details
4- (Benzyloxy) -3-ethoxybenzaldehyde
OR7894-02 1 g

4- (Benzyloxy) -3-ethoxybenzaldehyde

Sign In for Pricing
View Details
4- (Benzyloxy) -3-ethoxybenzaldehyde
OR7894-03 5 g

4- (Benzyloxy) -3-ethoxybenzaldehyde

Sign In for Pricing
View Details
4- (Benzyloxy) -3-ethoxybenzaldehyde
OR7894-04 100 g

4- (Benzyloxy) -3-ethoxybenzaldehyde

Sign In for Pricing
View Details