Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFF Rabbit pAb (APR19022N)

Product Specifications

Background

This is a nuclear gene encoding a protein that functions in mitochondrial and peroxisomal fission. The encoded protein recruits dynamin-1-like protein (DNM1L) to mitochondria. There are multiple pseudogenes for this gene on chromosomes 1, 5, and X. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MFF Rabbit pAb (APR19022N) .

Synonyms

MFF; C2orf33; EMPF2; GL004

Gene ID

56947

UniProt

Q9GZY8

Cellular Locus

Cytoplasmic vesicle, Mitochondrion outer membrane, Peroxisome, Single-pass type IV membrane protein, secretory vesicle, synaptic vesicle

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 25kDa/27kDa/32kDa/38kDa Observed MW: 38kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=56947

Uniprot URL

https://www.uniprot.org/uniprot/Q9GZY8

AA Sequence

SRAAFPSPTAAEMAEISRIQYEMEYTEGISQRMRVPEKLKVAPPNADLEQGFQEGVPNASVIMQVPERIVVAGNNEDVSFSRPADLDLIQSTPFKPLALKTPPRVLTLSERPLDFLDLERPPTTPQNEEIRAVGRLKRERSMSENAVRQNGQLVRN

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CD11b (CD11 antigen-like family member B, CD11b/CD18, CD49d, Cell surface glycoprotein MAC-1 subunit alpha, Complement Component Receptor 3 Alpha, CR3 Alpha Chain (CR3A), Integrin alpha-M, Integrin beta 2 alpha subunit, ITGAM, Leukocyte adhesion receptor
MBS6122620-01 0.1 mL

CD11b (CD11 antigen-like family member B, CD11b/CD18, CD49d, Cell surface glycoprotein MAC-1 subunit alpha, Complement Component Receptor 3 Alpha, CR3 Alpha Chain (CR3A), Integrin alpha-M, Integrin beta 2 alpha subunit, ITGAM, Leukocyte adhesion receptor

Ask
View Details
CD11b (CD11 antigen-like family member B, CD11b/CD18, CD49d, Cell surface glycoprotein MAC-1 subunit alpha, Complement Component Receptor 3 Alpha, CR3 Alpha Chain (CR3A), Integrin alpha-M, Integrin beta 2 alpha subunit, ITGAM, Leukocyte adhesion receptor
MBS6122620-02 5x 0.1 mL

CD11b (CD11 antigen-like family member B, CD11b/CD18, CD49d, Cell surface glycoprotein MAC-1 subunit alpha, Complement Component Receptor 3 Alpha, CR3 Alpha Chain (CR3A), Integrin alpha-M, Integrin beta 2 alpha subunit, ITGAM, Leukocyte adhesion receptor

Ask
View Details
CHDH Knockout jurkat Polyclonal Cells
ARG13795 1 Million

CHDH Knockout jurkat Polyclonal Cells

Ask
View Details
Recombinant Human DTK/TYRO3 Protein, Fc Tag
KMH1001 50 µg

Recombinant Human DTK/TYRO3 Protein, Fc Tag

Ask
View Details