Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGLEC6 Rabbit pAb (APR19017N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SIGLEC6 Rabbit pAb (APR19009N7) .

Synonyms

SIGLEC6; CD327; CD33L; CD33L1; CD33L2; CDW327; OBBP1

Gene ID

946

UniProt

O43699

Cellular Locus

Cell membrane, Secreted, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 37kDa/38kDa/42kDa/44kDa/48kDa/49kDa Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=946

Uniprot URL

https://www.uniprot.org/uniprot/O43699

AA Sequence

QERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PROCR (EPCR, Endothelial Protein C Receptor, Activated Protein C Receptor, APC Receptor, Endothelial Cell Protein C Receptor, CD201, bA42O4.2, MGC23024) (PE)
131849-PE 100 µL

PROCR (EPCR, Endothelial Protein C Receptor, Activated Protein C Receptor, APC Receptor, Endothelial Cell Protein C Receptor, CD201, bA42O4.2, MGC23024) (PE)

Sign In for Pricing
View Details
Rat Carboxypeptidase B1, Tissue (CPB1) ELISA Kit
RDR-CPB1-Ra-48Tests 48 Tests

Rat Carboxypeptidase B1, Tissue (CPB1) ELISA Kit

Sign In for Pricing
View Details
Human CYB5RL knockdown cell line
ABC-KD3828 1 Vial

Human CYB5RL knockdown cell line

Sign In for Pricing
View Details
Brn-3b CRISPR Activation Plasmid (m)
sc-422355-ACT 20 µg

Brn-3b CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Bridging Integrator 2 (BIN2)
MBS2081441-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Bridging Integrator 2 (BIN2)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Bridging Integrator 2 (BIN2)
MBS2081441-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Bridging Integrator 2 (BIN2)

Sign In for Pricing
View Details