Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3D Rabbit pAb (APR19009N)

Product Specifications

Background

The protein encoded by this gene is part of the T-cell receptor/CD3 complex (TCR/CD3 complex) and is involved in T-cell development and signal transduction. The encoded membrane protein represents the delta subunit of the CD3 complex, and along with four other CD3 subunits, binds either TCR alpha/beta or TCR gamma/delta to form the TCR/CD3 complex on the surface of T-cells. Defects in this gene are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (SCIDBNK) . Two transcript variants encoding different isoforms have been found for this gene. Other variants may also exist, but the full-length natures of their transcripts has yet to be defined.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD3D Rabbit pAb (APR19009N) .

Synonyms

CD3D; CD3-DELTA; IMD19; T3D

Gene ID

915

UniProt

P04234

Cellular Locus

Membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 14kDa/18kDa Observed MW: 19kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=915

Uniprot URL

https://www.uniprot.org/uniprot/P04234

AA Sequence

FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nr3c2 Mouse shRNA Plasmid (Locus ID 110784)
TR518242 1 Kit

Nr3c2 Mouse shRNA Plasmid (Locus ID 110784)

Sign In for Pricing
View Details
ALPL Polyclonal Antibody, Biotin Conjugated
A53199 100 µg

ALPL Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Monkey A Disintegrin And Metalloprotease 33, ADAM33 ELISA Kit
MBS7262392-01 48 Well

Monkey A Disintegrin And Metalloprotease 33, ADAM33 ELISA Kit

Sign In for Pricing
View Details
Monkey A Disintegrin And Metalloprotease 33, ADAM33 ELISA Kit
MBS7262392-02 96 Well

Monkey A Disintegrin And Metalloprotease 33, ADAM33 ELISA Kit

Sign In for Pricing
View Details
Monkey A Disintegrin And Metalloprotease 33, ADAM33 ELISA Kit
MBS7262392-03 5x 96 Well

Monkey A Disintegrin And Metalloprotease 33, ADAM33 ELISA Kit

Sign In for Pricing
View Details
Monkey A Disintegrin And Metalloprotease 33, ADAM33 ELISA Kit
MBS7262392-04 10x 96 Well

Monkey A Disintegrin And Metalloprotease 33, ADAM33 ELISA Kit

Sign In for Pricing
View Details