Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRPM5 Rabbit pAb (APR18994N)

Product Specifications

Background

This gene encodes a member of the transient receptor potential (TRP) protein family, which is a diverse group of proteins with structural features typical of ion channels. This protein plays an important role in taste transduction, and has characteristics of a calcium-activated, non-selective cation channel that carries Na+, K+, and Cs+ ions equally well, but not Ca (2+) ions. It is activated by lower concentrations of intracellular Ca (2+), and inhibited by higher concentrations. It is also a highly temperature-sensitive, heat activated channel showing a steep increase of inward currents at temperatures between 15 and 35 degrees Celsius. This gene is located within the Beckwith-Wiedemann syndrome critical region-1 on chromosome 11p15.5, and has been shown to be imprinted, with exclusive expression from the paternal allele.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TRPM5 Rabbit pAb (APR18994N) .

Synonyms

TRPM5; LTRPC5; MTR1

Gene ID

29850

UniProt

Q9NZQ8

Cellular Locus

Cell membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 97kDa/131kDa Observed MW: 112kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=29850

Uniprot URL

https://www.uniprot.org/uniprot/Q9NZQ8

AA Sequence

RVFKKEAEHKREHLERDLPDPLDQKVVTWETVQKENFLSKMEKRRRDSEGEVLRKTAHRVDFIAKYLGGLREQEKRIKCLESQINYCSVLVSSVADVLAQGGGPRSSQHCGEGSQLVAADHRGGLDGWEQPGAGQPPSDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHOP discontinued
534700-01 30ul

CHOP discontinued

Sign In for Pricing
View Details
CHOP discontinued
534700-02 100 µL

CHOP discontinued

Sign In for Pricing
View Details
Carcinoembryonic Antigen (Carcinoembryonic Antigen-related Cell Adhesion Molecule 5, CEACAM5, CD66e) (MaxLight 550)
MBS6214967-01 0.1 mL

Carcinoembryonic Antigen (Carcinoembryonic Antigen-related Cell Adhesion Molecule 5, CEACAM5, CD66e) (MaxLight 550)

Sign In for Pricing
View Details
Carcinoembryonic Antigen (Carcinoembryonic Antigen-related Cell Adhesion Molecule 5, CEACAM5, CD66e) (MaxLight 550)
MBS6214967-02 5x 0.1 mL

Carcinoembryonic Antigen (Carcinoembryonic Antigen-related Cell Adhesion Molecule 5, CEACAM5, CD66e) (MaxLight 550)

Sign In for Pricing
View Details
POLE3 Conjugated Antibody
C43062 100 µL

POLE3 Conjugated Antibody

Sign In for Pricing
View Details
NOMO2 Human Over-expression Lysate
orb1362515 20 µg

NOMO2 Human Over-expression Lysate

Sign In for Pricing
View Details