Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha 1 Spectrin Rabbit pAb (APR18983N)

Product Specifications

Background

Spectrin is an actin crosslinking and molecular scaffold protein that links the plasma membrane to the actin cytoskeleton, and functions in the determination of cell shape, arrangement of transmembrane proteins, and organization of organelles. It is a tetramer made up of alpha-beta dimers linked in a head-to-head arrangement. This gene is one member of a family of alpha-spectrin genes. The encoded protein is primarily composed of 22 spectrin repeats which are involved in dimer formation. It forms weaker tetramer interactions than non-erythrocytic alpha spectrin, which may increase the plasma membrane elasticity and deformability of red blood cells. Mutations in this gene result in a variety of hereditary red blood cell disorders, including elliptocytosis type 2, pyropoikilocytosis, and spherocytic hemolytic anemia.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality alpha 1 Spectrin Rabbit pAb (APR18980N5) .

Synonyms

SPTA1; EL2; HPP; HS3; SPH3; SPTA

Gene ID

6708

UniProt

P02549

Cellular Locus

Cytoplasm, cell cortex, cytoskeleton

Applications

IF (Mus musculus) IP (Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 279kDa/280kDa Observed MW: 300kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6708

Uniprot URL

https://www.uniprot.org/uniprot/P02549

AA Sequence

KHEAFLLDLNSFGDSMKALRNQANACQQQQAAPVEGVAGEQRVMALYDFQARSPREVTMKKGDVLTLLSSINKDWWKVEAADHQGIVPAVYVRRLAHDEFPMLPQRRREEPGNITQRQEQIENQYRSLLDRAEERRRRLLQRYNEFLLAYEAGDMLEWIQEKKAENTGVELDDVWELQKKFDEFQKDLNTNEPRLRDINKVADDLLFEGLLTPEGAQIRQE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1630 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV629938 1.0 µg DNA

Olr1630 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Mouse Proprotein convertase subtilisin/kexin type 7, PCSK7 ELISA Kit
MBS9323274-01 48 Well

Mouse Proprotein convertase subtilisin/kexin type 7, PCSK7 ELISA Kit

Sign In for Pricing
View Details
Mouse Proprotein convertase subtilisin/kexin type 7, PCSK7 ELISA Kit
MBS9323274-02 96 Well

Mouse Proprotein convertase subtilisin/kexin type 7, PCSK7 ELISA Kit

Sign In for Pricing
View Details
Mouse Proprotein convertase subtilisin/kexin type 7, PCSK7 ELISA Kit
MBS9323274-03 5x 96 Well

Mouse Proprotein convertase subtilisin/kexin type 7, PCSK7 ELISA Kit

Sign In for Pricing
View Details
Mouse Proprotein convertase subtilisin/kexin type 7, PCSK7 ELISA Kit
MBS9323274-04 10x 96 Well

Mouse Proprotein convertase subtilisin/kexin type 7, PCSK7 ELISA Kit

Sign In for Pricing
View Details
Human N-Acetylneuraminic Acid Synthase (NANS) ELISA Kit
RDR-NANS-Hu-01 96 Tests

Human N-Acetylneuraminic Acid Synthase (NANS) ELISA Kit

Sign In for Pricing
View Details