Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENO2 Rabbit pAb (APR18977N)

Product Specifications

Background

This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ENO2 Rabbit pAb (APR18975N1) .

Synonyms

ENO2; HEL-S-279; NSE; enolase 2

Gene ID

2026

UniProt

P09104

Cellular Locus

Cell membrane, Cytoplasm

Applications

IF (Rattus norvegicus)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 42kDa/47kDa Observed MW: 47KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2026

Uniprot URL

https://www.uniprot.org/uniprot/P09104

AA Sequence

VIKDKYGKDATNVGDEGGFAPNILENSEALELVKEAIDKAGYTEKIVIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALYQDFVRDYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDEARFAGHNFRNPSVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Ovine Tissue Inhibitors of Metalloproteinase 1 (TIMP1), N-His
AP7F24-01 1 mg

Recombinant Ovine Tissue Inhibitors of Metalloproteinase 1 (TIMP1), N-His

Sign In for Pricing
View Details
Recombinant Ovine Tissue Inhibitors of Metalloproteinase 1 (TIMP1), N-His
AP7F24-02 10 µg

Recombinant Ovine Tissue Inhibitors of Metalloproteinase 1 (TIMP1), N-His

Sign In for Pricing
View Details
Recombinant Ovine Tissue Inhibitors of Metalloproteinase 1 (TIMP1), N-His
AP7F24-03 200 µg

Recombinant Ovine Tissue Inhibitors of Metalloproteinase 1 (TIMP1), N-His

Sign In for Pricing
View Details
Recombinant Ovine Tissue Inhibitors of Metalloproteinase 1 (TIMP1), N-His
AP7F24-04 5 mg

Recombinant Ovine Tissue Inhibitors of Metalloproteinase 1 (TIMP1), N-His

Sign In for Pricing
View Details
Recombinant Ovine Tissue Inhibitors of Metalloproteinase 1 (TIMP1), N-His
AP7F24-05 50 µg

Recombinant Ovine Tissue Inhibitors of Metalloproteinase 1 (TIMP1), N-His

Sign In for Pricing
View Details
SFXN3 Antibody - middle region
ARP49989_P050-25UL 25 µL

SFXN3 Antibody - middle region

Sign In for Pricing
View Details