Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLRC1 Rabbit pAb (APR18969N)

Product Specifications

Background

Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor family, also called NKG2 family, which is a group of transmembrane proteins preferentially expressed in NK cells. This family of proteins is characterized by the type II membrane orientation and the presence of a C-type lectin domain. This protein forms a complex with another family member, KLRD1/CD94, and has been implicated in the recognition of the MHC class I HLA-E molecules in NK cells. The genes of NKG2 family members form a killer cell lectin-like receptor gene cluster on chromosome 12. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KLRC1 Rabbit pAb (APR18969N) .

Synonyms

KLRC1; CD159A; NKG2; NKG2A

Gene ID

3821

UniProt

P26715

Cellular Locus

Membrane, Single-pass type II membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 24kDa/26kDa Observed MW: 26kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3821

Uniprot URL

https://www.uniprot.org/uniprot/P26715

AA Sequence

RHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFNG Polyclonal Antibody
A51990 100 µg

IFNG Polyclonal Antibody

Sign In for Pricing
View Details
TRPV2 Rabbit Polyclonal Antibody
MBS9512839-01 0.05 mL

TRPV2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRPV2 Rabbit Polyclonal Antibody
MBS9512839-02 0.1 mL

TRPV2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRPV2 Rabbit Polyclonal Antibody
MBS9512839-03 5x 0.1 mL

TRPV2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CCDC15 Protein Vector (Human) (pPM-C-His)
PV067736 500 ng

CCDC15 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Pig ETFDH Protein, His-SUMO, E.coli-200ug
QP6003-ec-200ug 200ug

Recombinant Pig ETFDH Protein, His-SUMO, E.coli-200ug

Sign In for Pricing
View Details