Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGE receptor EP1 (PTGER1) Rabbit pAb (APR18956N)

Product Specifications

Background

The protein encoded by this gene is a member of the G protein-coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2) . Through a phosphatidylinositol-calcium second messenger system, G-Q proteins mediate this receptor's activity. Knockout studies in mice suggested a role of this receptor in mediating algesia and in regulation of blood pressure. Studies in mice also suggested that this gene may mediate adrenocorticotropic hormone response to bacterial endotoxin.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PGE receptor EP1 (PTGER1) Rabbit pAb (APR18956N) .

Synonyms

PTGER1; EP1

Gene ID

5731

UniProt

P34995

Cellular Locus

Cell membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 41kDa Observed MW: 42kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5731

Uniprot URL

https://www.uniprot.org/uniprot/P34995

AA Sequence

VGIMVVSCICWSPMLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWVYILLRQAVLRQLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Ubiquitin-like modifier-activating enzyme 6(UBA6), partial
MBS9021710-01 0.02 mg (Baculovirus)

Recombinant Human Ubiquitin-like modifier-activating enzyme 6(UBA6), partial

Sign In for Pricing
View Details
Recombinant Human Ubiquitin-like modifier-activating enzyme 6(UBA6), partial
MBS9021710-02 0.1 mg (Baculovirus)

Recombinant Human Ubiquitin-like modifier-activating enzyme 6(UBA6), partial

Sign In for Pricing
View Details
Recombinant Human Ubiquitin-like modifier-activating enzyme 6(UBA6), partial
MBS9021710-03 1 mg (Baculovirus)

Recombinant Human Ubiquitin-like modifier-activating enzyme 6(UBA6), partial

Sign In for Pricing
View Details
Recombinant Human Ubiquitin-like modifier-activating enzyme 6(UBA6), partial
MBS9021710-04 5x 1 mg (Baculovirus)

Recombinant Human Ubiquitin-like modifier-activating enzyme 6(UBA6), partial

Sign In for Pricing
View Details
SARS nucleocapsid (L pack)
JBS-PR-1452-L 1 mg

SARS nucleocapsid (L pack)

Sign In for Pricing
View Details
Aprataxin (APTX) (NM_001195254) Human Tagged ORF Clone
RG231131 10 µg

Aprataxin (APTX) (NM_001195254) Human Tagged ORF Clone

Sign In for Pricing
View Details