Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD127/IL7R Rabbit pAb (APR18948N)

Product Specifications

Background

The protein encoded by this gene is a receptor for interleukin 7 (IL7) . The function of this receptor requires the interleukin 2 receptor, gamma chain (IL2RG), which is a common gamma chain shared by the receptors of various cytokines, including interleukins 2, 4, 7, 9, and 15. This protein has been shown to play a critical role in V (D) J recombination during lymphocyte development. Defects in this gene may be associated with severe combined immunodeficiency (SCID) . Alternatively spliced transcript variants have been found.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD127/IL7R Rabbit pAb (APR18948N) .

Synonyms

IL7R; CD127; CDW127; IL-7R-alpha; IL7RA; ILRA

Gene ID

3575

UniProt

P16871

Cellular Locus

Cell membrane, Secreted, Single-pass type I membrane protein, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:20 - 1:50

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 65-90kDa Observed MW: 50KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3575

Uniprot URL

https://www.uniprot.org/uniprot/P16871

AA Sequence

ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMD

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ZBTB49 (Zinc Finger and BTB Domain Containing 49)
495866 100 µL

ZBTB49 (Zinc Finger and BTB Domain Containing 49)

Ask
View Details
Mouse Monoclonal Pancreatic Lipase Antibody (PNLIP/8913)
NBP3-26711-20ug 20 µg

Mouse Monoclonal Pancreatic Lipase Antibody (PNLIP/8913)

Ask
View Details
PKP4 (Plakophilin-4, p0071, PKP4) (FITC) discontinued
302647-FITC 200 µL

PKP4 (Plakophilin-4, p0071, PKP4) (FITC) discontinued

Ask
View Details
Alpha-2-Antiplasmin/Serpin F2, Human (HEK293, His)
HY-P76720 50 µg

Alpha-2-Antiplasmin/Serpin F2, Human (HEK293, His)

Ask
View Details
Synaptic adhesion-like molecule 2 (SALM2, LRFN1, leucine rich repeat and fibronectin type III domain containing 1, KIAA1484, Leucine-rich repeat and fibronectin type III domain-containing protein 1)
MBS621390-01 0.1 mg

Synaptic adhesion-like molecule 2 (SALM2, LRFN1, leucine rich repeat and fibronectin type III domain containing 1, KIAA1484, Leucine-rich repeat and fibronectin type III domain-containing protein 1)

Ask
View Details
Synaptic adhesion-like molecule 2 (SALM2, LRFN1, leucine rich repeat and fibronectin type III domain containing 1, KIAA1484, Leucine-rich repeat and fibronectin type III domain-containing protein 1)
MBS621390-02 5x 0.1 mg

Synaptic adhesion-like molecule 2 (SALM2, LRFN1, leucine rich repeat and fibronectin type III domain containing 1, KIAA1484, Leucine-rich repeat and fibronectin type III domain-containing protein 1)

Ask
View Details