Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PANX2 Rabbit pAb (APR18937N)

Product Specifications

Background

The protein encoded by this gene belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 1 are abundantly expressed in central nervous system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 1 may form cell type-specific gap junctions with distinct properties. Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PANX2 Rabbit pAb (APR18937N) .

Synonyms

PANX2; PX2; hPANX2

Gene ID

56666

UniProt

Q96RD6

Cellular Locus

Cell junction, Cell membrane, Multi-pass membrane protein, gap junction

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 55kDa/70kDa/74kDa Observed MW: 65kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=56666

Uniprot URL

https://www.uniprot.org/uniprot/Q96RD6

AA Sequence

FIFDKLHKVGIKTRRQWRRSQFCDINILAMFCNENRDHIKSLNRLDFITNESDLMYDNVVRQLLAALAQSNHDATPTVRDSGVQTVDPSANPAEPDGAAEPPVVKRPRKKMKWIPTSNPLPQPFKEPLAIMRVENSKAEKPKPARRKTATDTLIAPLLDRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Azoarcus sp. Cell division topological specificity factor (minE)
MBS1035768-01 0.02 mg (E-Coli)

Recombinant Azoarcus sp. Cell division topological specificity factor (minE)

Sign In for Pricing
View Details
Recombinant Azoarcus sp. Cell division topological specificity factor (minE)
MBS1035768-02 0.1 mg (E-Coli)

Recombinant Azoarcus sp. Cell division topological specificity factor (minE)

Sign In for Pricing
View Details
Recombinant Azoarcus sp. Cell division topological specificity factor (minE)
MBS1035768-03 0.02 mg (Yeast)

Recombinant Azoarcus sp. Cell division topological specificity factor (minE)

Sign In for Pricing
View Details
Recombinant Azoarcus sp. Cell division topological specificity factor (minE)
MBS1035768-04 0.1 mg (Yeast)

Recombinant Azoarcus sp. Cell division topological specificity factor (minE)

Sign In for Pricing
View Details
Recombinant Azoarcus sp. Cell division topological specificity factor (minE)
MBS1035768-05 0.02 mg (Baculovirus)

Recombinant Azoarcus sp. Cell division topological specificity factor (minE)

Sign In for Pricing
View Details
Recombinant Azoarcus sp. Cell division topological specificity factor (minE)
MBS1035768-06 1 mg (E-Coli)

Recombinant Azoarcus sp. Cell division topological specificity factor (minE)

Sign In for Pricing
View Details