Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP4 Rabbit pAb (APR18907N)

Product Specifications

Background

The protein encoded by this gene is a protease that deubiquitinates target proteins such as ADORA2A and TRIM21. The encoded protein shuttles between the nucleus and cytoplasm and is involved in maintaining operational fidelity in the endoplasmic reticulum. Three transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality USP4 Rabbit pAb (APR18907N) .

Synonyms

USP4; UNP; Unph

Gene ID

7375

UniProt

Q13107

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 35kDa/103kDa/108kDa Observed MW: 95kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7375

Uniprot URL

https://www.uniprot.org/uniprot/Q13107

AA Sequence

DDIFVYEVCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPGACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFAF3-set siRNA/shRNA/RNAi Lentivector (Human)
31634091 4x 500 ng

NDUFAF3-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Anti-MYH16 Antibody Picoband®, APC Conjugate
A15498-APC 100 µg/Vial

Anti-MYH16 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
PD-L1 (D26A), Fc fusion, Biotin-labeled
71313-2 50 µg

PD-L1 (D26A), Fc fusion, Biotin-labeled

Sign In for Pricing
View Details
4-Chloro-6-hydroxy-benzene-1,3-disulfonyl dichloride
sc-349284A 5 g

4-Chloro-6-hydroxy-benzene-1,3-disulfonyl dichloride

Sign In for Pricing
View Details
Side Access Racking for 10x 2inch Cryoboxes 290H x 140W x 290D
FRE6168 1 Each

Side Access Racking for 10x 2inch Cryoboxes 290H x 140W x 290D

Sign In for Pricing
View Details
4-Chlorobenzyl chloride
sc-254647A 500 g

4-Chlorobenzyl chloride

Sign In for Pricing
View Details